Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor Dp-2

Gene

TFDP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The TFDP2:E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F1:DP complex appears to mediate both cell proliferation and apoptosis. Blocks adipocyte differentiation by repressing CEBPA binding to its target gene promoters (PubMed:20176812).1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi129 – 210Sequence analysisAdd BLAST82

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • DNA-binding transcription factor activity Source: ProtInc
  • protein domain specific binding Source: UniProtKB
  • RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: NTNU_SB
  • transcription coregulator activity Source: ProtInc
  • transcription factor binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processCell cycle, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-111448 Activation of NOXA and translocation to mitochondria
R-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-1362300 Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1
R-HSA-139915 Activation of PUMA and translocation to mitochondria
R-HSA-1538133 G0 and Early G1
R-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-69202 Cyclin E associated events during G1/S transition
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8953750 Transcriptional Regulation by E2F6

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor Dp-2
Alternative name(s):
E2F dimerization partner 2
Gene namesi
Name:TFDP2
Synonyms:DP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114126.17
HGNCiHGNC:11751 TFDP2
MIMi602160 gene
neXtProtiNX_Q14188

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7029
OpenTargetsiENSG00000114126
PharmGKBiPA36466

Polymorphism and mutation databases

BioMutaiTFDP2
DMDMi8039810

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002194772 – 446Transcription factor Dp-2Add BLAST445

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1
Modified residuei24PhosphoserineCombined sources1
Modified residuei122PhosphoserineCombined sources1

Post-translational modificationi

Ser-24 is probably phosphorylated by CDK2.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ14188
MaxQBiQ14188
PaxDbiQ14188
PeptideAtlasiQ14188
PRIDEiQ14188
ProteomicsDBi59905
59906 [Q14188-2]
59907 [Q14188-3]
59908 [Q14188-4]
59909 [Q14188-5]
59910 [Q14188-6]

PTM databases

iPTMnetiQ14188
PhosphoSitePlusiQ14188

Expressioni

Tissue specificityi

High levels in heart and skeletal muscle. Also found in placenta, kidney, brain, lung and liver. The presence as well as the abundance of the different transcripts appear to vary significantly in different tissues and cell lines.

Gene expression databases

BgeeiENSG00000114126 Expressed in 218 organ(s), highest expression level in kidney
CleanExiHS_TFDP2
ExpressionAtlasiQ14188 baseline and differential
GenevisibleiQ14188 HS

Organism-specific databases

HPAiCAB018396

Interactioni

Subunit structurei

Component of the DRTF1/E2F transcription factor complex. Forms heterodimers with E2F family members. The complex can interact with hypophosphorylated retinoblastoma protein RB1 and related proteins (RBL1 and RBL2) that inhibit the E2F transactivation domain. During the cell cycle, RB becomes phosphorylated in mid-to-late G1 phase, detaches from the DRTF1/E2F complex rendering E2F transcriptionally active. Viral oncoproteins, notably E1A, T-antigen and HPV E7, are capable of sequestering RB protein, thus releasing the active complex. Interacts with GMCL (By similarity). Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. The complex TFDP2:E2F1 interacts with CEBPA; the interaction prevents CEBPA binding to target genes promoters and represses its transcriptional activity (PubMed:20176812).By similarity2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112887, 16 interactors
DIPiDIP-294N
IntActiQ14188, 10 interactors
MINTiQ14188
STRINGi9606.ENSP00000420616

Structurei

Secondary structure

1446
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14188
SMRiQ14188
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14188

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni60 – 82Interaction with CEBPA1 PublicationAdd BLAST23
Regioni219 – 292DimerizationSequence analysisAdd BLAST74
Regioni229 – 261DCB1Add BLAST33
Regioni274 – 330DCB2Add BLAST57

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi103 – 118Nuclear localization signalBy similarityAdd BLAST16
Motifi176 – 210DEF boxAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi432 – 446Asp/Glu-rich (acidic; NCB domain)Add BLAST15

Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Phylogenomic databases

eggNOGiKOG2829 Eukaryota
ENOG410Y9QP LUCA
GeneTreeiENSGT00390000018222
HOGENOMiHOG000030696
HOVERGENiHBG009894
InParanoidiQ14188
KOiK09392
OMAiEGYITDM
OrthoDBiEOG091G0AVY
PhylomeDBiQ14188
TreeFamiTF314396

Family and domain databases

CDDicd14458 DP_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
1.20.140.80, 1 hit
InterProiView protein in InterPro
IPR028314 DP-2
IPR037241 E2F-DP_heterodim
IPR003316 E2F_WHTH_DNA-bd_dom
IPR038168 TF_DP_C_sf
IPR014889 Transc_factor_DP_C
IPR015648 Transcrpt_fac_DP
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12548 PTHR12548, 1 hit
PTHR12548:SF5 PTHR12548:SF5, 1 hit
PfamiView protein in Pfam
PF08781 DP, 1 hit
PF02319 E2F_TDP, 1 hit
PIRSFiPIRSF009404 Transcription_factor_DP, 1 hit
SMARTiView protein in SMART
SM01138 DP, 1 hit
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 10 potential isoforms that are computationally mapped.iShow all

Isoform Alpha (identifier: Q14188-1) [UniParc]FASTAAdd to basket
Also known as: 49 kDa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTAKNVGLTS TNAEVRGFID QNLSPTKGNI SFVAFPVSNT NSPTKILPKT
60 70 80 90 100
LGPINVNVGP QMIISTPQRL TSSGSVLIGS PYTPAPAMVT QTHIAEATGW
110 120 130 140 150
VPGDRKRARK FIDSDFSESK RSKKGDKNGK GLRHFSMKVC EKVQRKGTTS
160 170 180 190 200
YNEVADELVS EFTNSNNHLA ADSAYDQKNI RRRVYDALNV LMAMNIISKE
210 220 230 240 250
KKEIKWIGLP TNSAQECQNL EIEKQRRIER IKQKRAQLQE LLLQQIAFKN
260 270 280 290 300
LVQRNRQNEQ QNQGPPALNS TIQLPFIIIN TSRKTVIDCS ISSDKFEYLF
310 320 330 340 350
NFDNTFEIHD DIEVLKRMGM SFGLESGKCS LEDLKLAKSL VPKALEGYIT
360 370 380 390 400
DISTGPSWLN QGLLLNSTQS VSNLDLTTGA TLPQSSVNQG LCLDAEVALA
410 420 430 440
TGQFLAPNSH QSSSAASHCS ESRGETPCSF NDEDEEDDEE DSSSPE
Length:446
Mass (Da):49,236
Last modified:May 30, 2000 - v2
Checksum:i19A6C85BAD61DFF1
GO
Isoform Beta (identifier: Q14188-2) [UniParc]FASTAAdd to basket
Also known as: 43 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     103-118: Missing.

Note: Gene prediction based on similarity to mouse ortholog. No experimental confirmation available.
Show »
Length:369
Mass (Da):40,948
Checksum:i95F7F33EAFE93A9E
GO
Isoform Gamma (identifier: Q14188-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     103-118: Missing.
     173-173: S → SQ

Note: Gene prediction based on similarity to mouse ortholog. No experimental confirmation available.
Show »
Length:370
Mass (Da):41,076
Checksum:i35ED26B84C6B4545
GO
Isoform Delta (identifier: Q14188-4) [UniParc]FASTAAdd to basket
Also known as: 48 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.

Show »
Length:385
Mass (Da):42,857
Checksum:iCFB1E7BE8C9439B2
GO
Isoform Epsilon (identifier: Q14188-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     173-173: S → SQ

Show »
Length:386
Mass (Da):42,985
Checksum:i08F760ACCC483846
GO
Isoform 6 (identifier: Q14188-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MTAKNV → MLDPKC
     7-103: Missing.

Show »
Length:349
Mass (Da):39,238
Checksum:i230EEB6A470CACA9
GO
Isoform 7 (identifier: Q14188-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.

Note: No experimental confirmation available.
Show »
Length:310
Mass (Da):34,686
Checksum:i47C7A015A2A79CB0
GO
Isoform 8 (identifier: Q14188-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MTAKNVGLTS...PINVNVGPQM → MQPEGIIFEAENKPSPGTESAGTFILDLSATSRT

Note: No experimental confirmation available.
Show »
Length:418
Mass (Da):46,304
Checksum:iC15F9B7F7FCCB8FF
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J461C9J461_HUMAN
Transcription factor Dp-2
TFDP2
220Annotation score:
C9J977C9J977_HUMAN
Transcription factor Dp-2
TFDP2
206Annotation score:
C9J872C9J872_HUMAN
Transcription factor Dp-2
TFDP2
248Annotation score:
H7C5C2H7C5C2_HUMAN
Transcription factor Dp-2
TFDP2
114Annotation score:
C9JNB6C9JNB6_HUMAN
Transcription factor Dp-2
TFDP2
89Annotation score:
F8WAY9F8WAY9_HUMAN
Transcription factor Dp-2
TFDP2
70Annotation score:
C9J5D5C9J5D5_HUMAN
Transcription factor Dp-2
TFDP2
46Annotation score:
C9JTZ9C9JTZ9_HUMAN
Transcription factor Dp-2
TFDP2
85Annotation score:
C9JCY5C9JCY5_HUMAN
Transcription factor Dp-2
TFDP2
27Annotation score:
R4GN09R4GN09_HUMAN
Transcription factor Dp-2
TFDP2
67Annotation score:

Sequence cautioni

The sequence AAR89905 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAB45775 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti269N → S in BAH13914 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00227264I → T. Corresponds to variant dbSNP:rs748095099Ensembl.1
Natural variantiVAR_02056781P → S1 PublicationCorresponds to variant dbSNP:rs11569200Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0454551 – 136Missing in isoform 7. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_0474151 – 62MTAKN…VGPQM → MQPEGIIFEAENKPSPGTES AGTFILDLSATSRT in isoform 8. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0013521 – 61Missing in isoform Beta, isoform Gamma, isoform Delta and isoform Epsilon. 4 PublicationsAdd BLAST61
Alternative sequenceiVSP_0431401 – 6MTAKNV → MLDPKC in isoform 6. 1 Publication6
Alternative sequenceiVSP_0431417 – 103Missing in isoform 6. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_001353103 – 118Missing in isoform Beta and isoform Gamma. CuratedAdd BLAST16
Alternative sequenceiVSP_001354173S → SQ in isoform Gamma and isoform Epsilon. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L40386 mRNA Translation: AAA69016.1
U18422 mRNA Translation: AAB60378.1
AY509596 Genomic DNA Translation: AAR89905.1 Sequence problems.
AK303181 mRNA Translation: BAH13914.1
AK303634 mRNA Translation: BAH14001.1
CR597951 mRNA No translation available.
AC108679 Genomic DNA No translation available.
AC112504 Genomic DNA No translation available.
AC128648 Genomic DNA No translation available.
AC133435 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78977.1
CH471052 Genomic DNA Translation: EAW78981.1
BC021113 mRNA Translation: AAH21113.1
U75488 mRNA Translation: AAB37321.1
AL080206 mRNA Translation: CAB45775.2 Different initiation.
U35117 mRNA Translation: AAC50642.1
CCDSiCCDS43159.1 [Q14188-5]
CCDS54647.1 [Q14188-7]
CCDS54648.1 [Q14188-8]
CCDS54649.1 [Q14188-6]
CCDS54650.1 [Q14188-1]
RefSeqiNP_001171609.1, NM_001178138.1 [Q14188-5]
NP_001171610.1, NM_001178139.1 [Q14188-1]
NP_001171611.1, NM_001178140.1 [Q14188-8]
NP_001171612.1, NM_001178141.1 [Q14188-6]
NP_001171613.1, NM_001178142.1 [Q14188-7]
NP_006277.1, NM_006286.4 [Q14188-5]
XP_016862580.1, XM_017007091.1 [Q14188-1]
XP_016862585.1, XM_017007096.1 [Q14188-5]
XP_016862586.1, XM_017007097.1 [Q14188-4]
XP_016862587.1, XM_017007098.1 [Q14188-5]
XP_016862588.1, XM_017007099.1 [Q14188-4]
UniGeneiHs.379018

Genome annotation databases

EnsembliENST00000467072; ENSP00000418590; ENSG00000114126 [Q14188-5]
ENST00000477292; ENSP00000418971; ENSG00000114126 [Q14188-7]
ENST00000479040; ENSP00000417585; ENSG00000114126 [Q14188-4]
ENST00000486111; ENSP00000420599; ENSG00000114126 [Q14188-5]
ENST00000489671; ENSP00000420616; ENSG00000114126 [Q14188-1]
ENST00000495310; ENSP00000419036; ENSG00000114126 [Q14188-6]
ENST00000499676; ENSP00000439782; ENSG00000114126 [Q14188-8]
GeneIDi7029
KEGGihsa:7029
UCSCiuc003euk.5 human [Q14188-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L40386 mRNA Translation: AAA69016.1
U18422 mRNA Translation: AAB60378.1
AY509596 Genomic DNA Translation: AAR89905.1 Sequence problems.
AK303181 mRNA Translation: BAH13914.1
AK303634 mRNA Translation: BAH14001.1
CR597951 mRNA No translation available.
AC108679 Genomic DNA No translation available.
AC112504 Genomic DNA No translation available.
AC128648 Genomic DNA No translation available.
AC133435 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78977.1
CH471052 Genomic DNA Translation: EAW78981.1
BC021113 mRNA Translation: AAH21113.1
U75488 mRNA Translation: AAB37321.1
AL080206 mRNA Translation: CAB45775.2 Different initiation.
U35117 mRNA Translation: AAC50642.1
CCDSiCCDS43159.1 [Q14188-5]
CCDS54647.1 [Q14188-7]
CCDS54648.1 [Q14188-8]
CCDS54649.1 [Q14188-6]
CCDS54650.1 [Q14188-1]
RefSeqiNP_001171609.1, NM_001178138.1 [Q14188-5]
NP_001171610.1, NM_001178139.1 [Q14188-1]
NP_001171611.1, NM_001178140.1 [Q14188-8]
NP_001171612.1, NM_001178141.1 [Q14188-6]
NP_001171613.1, NM_001178142.1 [Q14188-7]
NP_006277.1, NM_006286.4 [Q14188-5]
XP_016862580.1, XM_017007091.1 [Q14188-1]
XP_016862585.1, XM_017007096.1 [Q14188-5]
XP_016862586.1, XM_017007097.1 [Q14188-4]
XP_016862587.1, XM_017007098.1 [Q14188-5]
XP_016862588.1, XM_017007099.1 [Q14188-4]
UniGeneiHs.379018

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CF7X-ray2.60B121-215[»]
ProteinModelPortaliQ14188
SMRiQ14188
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112887, 16 interactors
DIPiDIP-294N
IntActiQ14188, 10 interactors
MINTiQ14188
STRINGi9606.ENSP00000420616

PTM databases

iPTMnetiQ14188
PhosphoSitePlusiQ14188

Polymorphism and mutation databases

BioMutaiTFDP2
DMDMi8039810

Proteomic databases

EPDiQ14188
MaxQBiQ14188
PaxDbiQ14188
PeptideAtlasiQ14188
PRIDEiQ14188
ProteomicsDBi59905
59906 [Q14188-2]
59907 [Q14188-3]
59908 [Q14188-4]
59909 [Q14188-5]
59910 [Q14188-6]

Protocols and materials databases

DNASUi7029
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000467072; ENSP00000418590; ENSG00000114126 [Q14188-5]
ENST00000477292; ENSP00000418971; ENSG00000114126 [Q14188-7]
ENST00000479040; ENSP00000417585; ENSG00000114126 [Q14188-4]
ENST00000486111; ENSP00000420599; ENSG00000114126 [Q14188-5]
ENST00000489671; ENSP00000420616; ENSG00000114126 [Q14188-1]
ENST00000495310; ENSP00000419036; ENSG00000114126 [Q14188-6]
ENST00000499676; ENSP00000439782; ENSG00000114126 [Q14188-8]
GeneIDi7029
KEGGihsa:7029
UCSCiuc003euk.5 human [Q14188-1]

Organism-specific databases

CTDi7029
DisGeNETi7029
EuPathDBiHostDB:ENSG00000114126.17
GeneCardsiTFDP2
HGNCiHGNC:11751 TFDP2
HPAiCAB018396
MIMi602160 gene
neXtProtiNX_Q14188
OpenTargetsiENSG00000114126
PharmGKBiPA36466
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2829 Eukaryota
ENOG410Y9QP LUCA
GeneTreeiENSGT00390000018222
HOGENOMiHOG000030696
HOVERGENiHBG009894
InParanoidiQ14188
KOiK09392
OMAiEGYITDM
OrthoDBiEOG091G0AVY
PhylomeDBiQ14188
TreeFamiTF314396

Enzyme and pathway databases

ReactomeiR-HSA-111448 Activation of NOXA and translocation to mitochondria
R-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-1362300 Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1
R-HSA-139915 Activation of PUMA and translocation to mitochondria
R-HSA-1538133 G0 and Early G1
R-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-69202 Cyclin E associated events during G1/S transition
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8953750 Transcriptional Regulation by E2F6

Miscellaneous databases

ChiTaRSiTFDP2 human
EvolutionaryTraceiQ14188
GeneWikiiTFDP2
GenomeRNAii7029
PROiPR:Q14188
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114126 Expressed in 218 organ(s), highest expression level in kidney
CleanExiHS_TFDP2
ExpressionAtlasiQ14188 baseline and differential
GenevisibleiQ14188 HS

Family and domain databases

CDDicd14458 DP_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
1.20.140.80, 1 hit
InterProiView protein in InterPro
IPR028314 DP-2
IPR037241 E2F-DP_heterodim
IPR003316 E2F_WHTH_DNA-bd_dom
IPR038168 TF_DP_C_sf
IPR014889 Transc_factor_DP_C
IPR015648 Transcrpt_fac_DP
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12548 PTHR12548, 1 hit
PTHR12548:SF5 PTHR12548:SF5, 1 hit
PfamiView protein in Pfam
PF08781 DP, 1 hit
PF02319 E2F_TDP, 1 hit
PIRSFiPIRSF009404 Transcription_factor_DP, 1 hit
SMARTiView protein in SMART
SM01138 DP, 1 hit
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTFDP2_HUMAN
AccessioniPrimary (citable) accession number: Q14188
Secondary accession number(s): B7Z8C8
, B7Z8L5, D3DNG1, E9PFC3, F8WAI2, Q13331, Q14187, Q6R754, Q8WU88, Q9UG28
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: September 12, 2018
This is version 180 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again