Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (13 Feb 2019)
Sequence version 2 (30 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transcription factor Dp-2

Gene

TFDP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The TFDP2:E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F1:DP complex appears to mediate both cell proliferation and apoptosis. Blocks adipocyte differentiation by repressing CEBPA binding to its target gene promoters (PubMed:20176812).1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi129 – 210Sequence analysisAdd BLAST82

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processCell cycle, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111448 Activation of NOXA and translocation to mitochondria
R-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-1362300 Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1
R-HSA-139915 Activation of PUMA and translocation to mitochondria
R-HSA-1538133 G0 and Early G1
R-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-69202 Cyclin E associated events during G1/S transition
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8953750 Transcriptional Regulation by E2F6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor Dp-2
Alternative name(s):
E2F dimerization partner 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TFDP2
Synonyms:DP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000114126.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11751 TFDP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602160 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14188

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7029

Open Targets

More...
OpenTargetsi
ENSG00000114126

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36466

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TFDP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
8039810

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002194772 – 446Transcription factor Dp-2Add BLAST445

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonineCombined sources1
Modified residuei24PhosphoserineCombined sources1
Modified residuei122PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ser-24 is probably phosphorylated by CDK2.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14188

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14188

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14188

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14188

PeptideAtlas

More...
PeptideAtlasi
Q14188

PRoteomics IDEntifications database

More...
PRIDEi
Q14188

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59905
59906 [Q14188-2]
59907 [Q14188-3]
59908 [Q14188-4]
59909 [Q14188-5]
59910 [Q14188-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14188

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14188

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High levels in heart and skeletal muscle. Also found in placenta, kidney, brain, lung and liver. The presence as well as the abundance of the different transcripts appear to vary significantly in different tissues and cell lines.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000114126 Expressed in 218 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14188 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14188 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018396

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the DRTF1/E2F transcription factor complex. Forms heterodimers with E2F family members. The complex can interact with hypophosphorylated retinoblastoma protein RB1 and related proteins (RBL1 and RBL2) that inhibit the E2F transactivation domain. During the cell cycle, RB becomes phosphorylated in mid-to-late G1 phase, detaches from the DRTF1/E2F complex rendering E2F transcriptionally active. Viral oncoproteins, notably E1A, T-antigen and HPV E7, are capable of sequestering RB protein, thus releasing the active complex. Interacts with GMCL (By similarity). Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. The complex TFDP2:E2F1 interacts with CEBPA; the interaction prevents CEBPA binding to target genes promoters and represses its transcriptional activity (PubMed:20176812).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112887, 16 interactors

Database of interacting proteins

More...
DIPi
DIP-294N

Protein interaction database and analysis system

More...
IntActi
Q14188, 10 interactors

Molecular INTeraction database

More...
MINTi
Q14188

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000420616

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1446
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CF7X-ray2.60B121-215[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14188

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14188

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14188

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni60 – 82Interaction with CEBPA1 PublicationAdd BLAST23
Regioni219 – 292DimerizationSequence analysisAdd BLAST74
Regioni229 – 261DCB1Add BLAST33
Regioni274 – 330DCB2Add BLAST57

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi103 – 118Nuclear localization signalBy similarityAdd BLAST16
Motifi176 – 210DEF boxAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi432 – 446Asp/Glu-rich (acidic; NCB domain)Add BLAST15

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2829 Eukaryota
ENOG410Y9QP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157909

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000030696

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG009894

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14188

KEGG Orthology (KO)

More...
KOi
K09392

Identification of Orthologs from Complete Genome Data

More...
OMAi
EGYITDM

Database of Orthologous Groups

More...
OrthoDBi
1046304at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14188

TreeFam database of animal gene trees

More...
TreeFami
TF314396

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14458 DP_DD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit
1.20.140.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028314 DP-2
IPR037241 E2F-DP_heterodim
IPR003316 E2F_WHTH_DNA-bd_dom
IPR038168 TF_DP_C_sf
IPR014889 Transc_factor_DP_C
IPR015648 Transcrpt_fac_DP
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12548 PTHR12548, 1 hit
PTHR12548:SF5 PTHR12548:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08781 DP, 1 hit
PF02319 E2F_TDP, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF009404 Transcription_factor_DP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01138 DP, 1 hit
SM01372 E2F_TDP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: Q14188-1) [UniParc]FASTAAdd to basket
Also known as: 49 kDa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTAKNVGLTS TNAEVRGFID QNLSPTKGNI SFVAFPVSNT NSPTKILPKT
60 70 80 90 100
LGPINVNVGP QMIISTPQRL TSSGSVLIGS PYTPAPAMVT QTHIAEATGW
110 120 130 140 150
VPGDRKRARK FIDSDFSESK RSKKGDKNGK GLRHFSMKVC EKVQRKGTTS
160 170 180 190 200
YNEVADELVS EFTNSNNHLA ADSAYDQKNI RRRVYDALNV LMAMNIISKE
210 220 230 240 250
KKEIKWIGLP TNSAQECQNL EIEKQRRIER IKQKRAQLQE LLLQQIAFKN
260 270 280 290 300
LVQRNRQNEQ QNQGPPALNS TIQLPFIIIN TSRKTVIDCS ISSDKFEYLF
310 320 330 340 350
NFDNTFEIHD DIEVLKRMGM SFGLESGKCS LEDLKLAKSL VPKALEGYIT
360 370 380 390 400
DISTGPSWLN QGLLLNSTQS VSNLDLTTGA TLPQSSVNQG LCLDAEVALA
410 420 430 440
TGQFLAPNSH QSSSAASHCS ESRGETPCSF NDEDEEDDEE DSSSPE
Length:446
Mass (Da):49,236
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i19A6C85BAD61DFF1
GO
Isoform Beta (identifier: Q14188-2) [UniParc]FASTAAdd to basket
Also known as: 43 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     103-118: Missing.

Note: Gene prediction based on similarity to mouse ortholog. No experimental confirmation available.
Show »
Length:369
Mass (Da):40,948
Checksum:i95F7F33EAFE93A9E
GO
Isoform Gamma (identifier: Q14188-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     103-118: Missing.
     173-173: S → SQ

Note: Gene prediction based on similarity to mouse ortholog. No experimental confirmation available.
Show »
Length:370
Mass (Da):41,076
Checksum:i35ED26B84C6B4545
GO
Isoform Delta (identifier: Q14188-4) [UniParc]FASTAAdd to basket
Also known as: 48 kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.

Show »
Length:385
Mass (Da):42,857
Checksum:iCFB1E7BE8C9439B2
GO
Isoform Epsilon (identifier: Q14188-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     173-173: S → SQ

Show »
Length:386
Mass (Da):42,985
Checksum:i08F760ACCC483846
GO
Isoform 6 (identifier: Q14188-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MTAKNV → MLDPKC
     7-103: Missing.

Show »
Length:349
Mass (Da):39,238
Checksum:i230EEB6A470CACA9
GO
Isoform 7 (identifier: Q14188-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.

Note: No experimental confirmation available.
Show »
Length:310
Mass (Da):34,686
Checksum:i47C7A015A2A79CB0
GO
Isoform 8 (identifier: Q14188-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MTAKNVGLTS...PINVNVGPQM → MQPEGIIFEAENKPSPGTESAGTFILDLSATSRT

Note: No experimental confirmation available.
Show »
Length:418
Mass (Da):46,304
Checksum:iC15F9B7F7FCCB8FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J977C9J977_HUMAN
Transcription factor Dp-2
TFDP2
206Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J872C9J872_HUMAN
Transcription factor Dp-2
TFDP2
248Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J461C9J461_HUMAN
Transcription factor Dp-2
TFDP2
220Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5C2H7C5C2_HUMAN
Transcription factor Dp-2
TFDP2
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNB6C9JNB6_HUMAN
Transcription factor Dp-2
TFDP2
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAY9F8WAY9_HUMAN
Transcription factor Dp-2
TFDP2
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTZ9C9JTZ9_HUMAN
Transcription factor Dp-2
TFDP2
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5D5C9J5D5_HUMAN
Transcription factor Dp-2
TFDP2
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCY5C9JCY5_HUMAN
Transcription factor Dp-2
TFDP2
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN09R4GN09_HUMAN
Transcription factor Dp-2
TFDP2
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAR89905 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAB45775 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti269N → S in BAH13914 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_00227264I → T. Corresponds to variant dbSNP:rs748095099Ensembl.1
Natural variantiVAR_02056781P → S1 PublicationCorresponds to variant dbSNP:rs11569200Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0454551 – 136Missing in isoform 7. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_0474151 – 62MTAKN…VGPQM → MQPEGIIFEAENKPSPGTES AGTFILDLSATSRT in isoform 8. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0013521 – 61Missing in isoform Beta, isoform Gamma, isoform Delta and isoform Epsilon. 4 PublicationsAdd BLAST61
Alternative sequenceiVSP_0431401 – 6MTAKNV → MLDPKC in isoform 6. 1 Publication6
Alternative sequenceiVSP_0431417 – 103Missing in isoform 6. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_001353103 – 118Missing in isoform Beta and isoform Gamma. CuratedAdd BLAST16
Alternative sequenceiVSP_001354173S → SQ in isoform Gamma and isoform Epsilon. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L40386 mRNA Translation: AAA69016.1
U18422 mRNA Translation: AAB60378.1
AY509596 Genomic DNA Translation: AAR89905.1 Sequence problems.
AK303181 mRNA Translation: BAH13914.1
AK303634 mRNA Translation: BAH14001.1
CR597951 mRNA No translation available.
AC108679 Genomic DNA No translation available.
AC112504 Genomic DNA No translation available.
AC128648 Genomic DNA No translation available.
AC133435 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78977.1
CH471052 Genomic DNA Translation: EAW78981.1
BC021113 mRNA Translation: AAH21113.1
U75488 mRNA Translation: AAB37321.1
AL080206 mRNA Translation: CAB45775.2 Different initiation.
U35117 mRNA Translation: AAC50642.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43159.1 [Q14188-5]
CCDS54647.1 [Q14188-7]
CCDS54648.1 [Q14188-8]
CCDS54649.1 [Q14188-6]
CCDS54650.1 [Q14188-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001171609.1, NM_001178138.1 [Q14188-5]
NP_001171610.1, NM_001178139.1 [Q14188-1]
NP_001171611.1, NM_001178140.1 [Q14188-8]
NP_001171612.1, NM_001178141.1 [Q14188-6]
NP_001171613.1, NM_001178142.1 [Q14188-7]
NP_006277.1, NM_006286.4 [Q14188-5]
XP_016862580.1, XM_017007091.1 [Q14188-1]
XP_016862585.1, XM_017007096.1
XP_016862586.1, XM_017007097.1 [Q14188-4]
XP_016862587.1, XM_017007098.1 [Q14188-5]
XP_016862588.1, XM_017007099.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.379018

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000467072; ENSP00000418590; ENSG00000114126 [Q14188-5]
ENST00000477292; ENSP00000418971; ENSG00000114126 [Q14188-7]
ENST00000479040; ENSP00000417585; ENSG00000114126 [Q14188-4]
ENST00000486111; ENSP00000420599; ENSG00000114126 [Q14188-5]
ENST00000489671; ENSP00000420616; ENSG00000114126 [Q14188-1]
ENST00000495310; ENSP00000419036; ENSG00000114126 [Q14188-6]
ENST00000499676; ENSP00000439782; ENSG00000114126 [Q14188-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7029

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7029

UCSC genome browser

More...
UCSCi
uc003euk.5 human [Q14188-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L40386 mRNA Translation: AAA69016.1
U18422 mRNA Translation: AAB60378.1
AY509596 Genomic DNA Translation: AAR89905.1 Sequence problems.
AK303181 mRNA Translation: BAH13914.1
AK303634 mRNA Translation: BAH14001.1
CR597951 mRNA No translation available.
AC108679 Genomic DNA No translation available.
AC112504 Genomic DNA No translation available.
AC128648 Genomic DNA No translation available.
AC133435 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78977.1
CH471052 Genomic DNA Translation: EAW78981.1
BC021113 mRNA Translation: AAH21113.1
U75488 mRNA Translation: AAB37321.1
AL080206 mRNA Translation: CAB45775.2 Different initiation.
U35117 mRNA Translation: AAC50642.1
CCDSiCCDS43159.1 [Q14188-5]
CCDS54647.1 [Q14188-7]
CCDS54648.1 [Q14188-8]
CCDS54649.1 [Q14188-6]
CCDS54650.1 [Q14188-1]
RefSeqiNP_001171609.1, NM_001178138.1 [Q14188-5]
NP_001171610.1, NM_001178139.1 [Q14188-1]
NP_001171611.1, NM_001178140.1 [Q14188-8]
NP_001171612.1, NM_001178141.1 [Q14188-6]
NP_001171613.1, NM_001178142.1 [Q14188-7]
NP_006277.1, NM_006286.4 [Q14188-5]
XP_016862580.1, XM_017007091.1 [Q14188-1]
XP_016862585.1, XM_017007096.1
XP_016862586.1, XM_017007097.1 [Q14188-4]
XP_016862587.1, XM_017007098.1 [Q14188-5]
XP_016862588.1, XM_017007099.1
UniGeneiHs.379018

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CF7X-ray2.60B121-215[»]
ProteinModelPortaliQ14188
SMRiQ14188
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112887, 16 interactors
DIPiDIP-294N
IntActiQ14188, 10 interactors
MINTiQ14188
STRINGi9606.ENSP00000420616

PTM databases

iPTMnetiQ14188
PhosphoSitePlusiQ14188

Polymorphism and mutation databases

BioMutaiTFDP2
DMDMi8039810

Proteomic databases

EPDiQ14188
jPOSTiQ14188
MaxQBiQ14188
PaxDbiQ14188
PeptideAtlasiQ14188
PRIDEiQ14188
ProteomicsDBi59905
59906 [Q14188-2]
59907 [Q14188-3]
59908 [Q14188-4]
59909 [Q14188-5]
59910 [Q14188-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7029
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000467072; ENSP00000418590; ENSG00000114126 [Q14188-5]
ENST00000477292; ENSP00000418971; ENSG00000114126 [Q14188-7]
ENST00000479040; ENSP00000417585; ENSG00000114126 [Q14188-4]
ENST00000486111; ENSP00000420599; ENSG00000114126 [Q14188-5]
ENST00000489671; ENSP00000420616; ENSG00000114126 [Q14188-1]
ENST00000495310; ENSP00000419036; ENSG00000114126 [Q14188-6]
ENST00000499676; ENSP00000439782; ENSG00000114126 [Q14188-8]
GeneIDi7029
KEGGihsa:7029
UCSCiuc003euk.5 human [Q14188-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7029
DisGeNETi7029
EuPathDBiHostDB:ENSG00000114126.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TFDP2
HGNCiHGNC:11751 TFDP2
HPAiCAB018396
MIMi602160 gene
neXtProtiNX_Q14188
OpenTargetsiENSG00000114126
PharmGKBiPA36466

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2829 Eukaryota
ENOG410Y9QP LUCA
GeneTreeiENSGT00940000157909
HOGENOMiHOG000030696
HOVERGENiHBG009894
InParanoidiQ14188
KOiK09392
OMAiEGYITDM
OrthoDBi1046304at2759
PhylomeDBiQ14188
TreeFamiTF314396

Enzyme and pathway databases

ReactomeiR-HSA-111448 Activation of NOXA and translocation to mitochondria
R-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-1362300 Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1
R-HSA-139915 Activation of PUMA and translocation to mitochondria
R-HSA-1538133 G0 and Early G1
R-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-69202 Cyclin E associated events during G1/S transition
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8953750 Transcriptional Regulation by E2F6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TFDP2 human
EvolutionaryTraceiQ14188

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TFDP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7029

Protein Ontology

More...
PROi
PR:Q14188

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000114126 Expressed in 218 organ(s), highest expression level in kidney
ExpressionAtlasiQ14188 baseline and differential
GenevisibleiQ14188 HS

Family and domain databases

CDDicd14458 DP_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
1.20.140.80, 1 hit
InterProiView protein in InterPro
IPR028314 DP-2
IPR037241 E2F-DP_heterodim
IPR003316 E2F_WHTH_DNA-bd_dom
IPR038168 TF_DP_C_sf
IPR014889 Transc_factor_DP_C
IPR015648 Transcrpt_fac_DP
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12548 PTHR12548, 1 hit
PTHR12548:SF5 PTHR12548:SF5, 1 hit
PfamiView protein in Pfam
PF08781 DP, 1 hit
PF02319 E2F_TDP, 1 hit
PIRSFiPIRSF009404 Transcription_factor_DP, 1 hit
SMARTiView protein in SMART
SM01138 DP, 1 hit
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTFDP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14188
Secondary accession number(s): B7Z8C8
, B7Z8L5, D3DNG1, E9PFC3, F8WAI2, Q13331, Q14187, Q6R754, Q8WU88, Q9UG28
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: February 13, 2019
This is version 185 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again