Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA polymerase alpha subunit B

Gene

POLA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play an essential role at the early stage of chromosomal DNA replication by coupling the polymerase alpha/primase complex to the cellular replication machinery.By similarity

GO - Molecular functioni

  • DNA binding Source: InterPro
  • DNA-directed DNA polymerase activity Source: InterPro
  • protein heterodimerization activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processDNA replication

Enzyme and pathway databases

ReactomeiR-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-174411 Polymerase switching on the C-strand of the telomere
R-HSA-174430 Telomere C-strand synthesis initiation
R-HSA-68952 DNA replication initiation
R-HSA-68962 Activation of the pre-replicative complex
R-HSA-69091 Polymerase switching
R-HSA-69166 Removal of the Flap Intermediate
R-HSA-69183 Processive synthesis on the lagging strand

Names & Taxonomyi

Protein namesi
Recommended name:
DNA polymerase alpha subunit B
Alternative name(s):
DNA polymerase alpha 70 kDa subunit
Gene namesi
Name:POLA2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000014138.8
HGNCiHGNC:30073 POLA2
neXtProtiNX_Q14181

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23649
OpenTargetsiENSG00000014138
PharmGKBiPA411

Chemistry databases

ChEMBLiCHEMBL2363042
DrugBankiDB00851 Dacarbazine

Polymorphism and mutation databases

BioMutaiPOLA2
DMDMi90110415

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001940351 – 598DNA polymerase alpha subunit BAdd BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei126PhosphoserineCombined sources1
Modified residuei127PhosphothreonineCombined sources1
Modified residuei130PhosphothreonineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Modified residuei147PhosphoserineCombined sources1
Modified residuei152PhosphoserineCombined sources1
Modified residuei154PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated in a cell cycle-dependent manner, in G2/M phase.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ14181
MaxQBiQ14181
PaxDbiQ14181
PeptideAtlasiQ14181
PRIDEiQ14181
ProteomicsDBi59900

PTM databases

iPTMnetiQ14181
PhosphoSitePlusiQ14181

Expressioni

Gene expression databases

BgeeiENSG00000014138 Expressed in 168 organ(s), highest expression level in embryo
CleanExiHS_POLA2
ExpressionAtlasiQ14181 baseline and differential
GenevisibleiQ14181 HS

Organism-specific databases

HPAiHPA037570

Interactioni

Subunit structurei

DNA polymerase alpha:primase is a four subunit enzyme complex, which is assembled throughout the cell cycle, and consists of the two DNA polymerase subunits A and B, and the DNA primase large and small subunits. Subunit B binds to subunit A.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117176, 63 interactors
ComplexPortaliCPX-2087 DNA polymerase alpha:primase complex
CORUMiQ14181
IntActiQ14181, 36 interactors
MINTiQ14181
STRINGi9606.ENSP00000265465

Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14181
SMRiQ14181
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14181

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi101 – 107Poly-Glu7
Compositional biasi115 – 157Pro/Ser/Thr-richAdd BLAST43
Compositional biasi486 – 489Poly-Ser4

Domaini

The N-terminal 240 amino acids are sufficient to mediate complex formation.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1625 Eukaryota
COG5214 LUCA
GeneTreeiENSGT00390000016784
HOGENOMiHOG000007382
HOVERGENiHBG055628
InParanoidiQ14181
KOiK02321
OMAiYLVEQRH
OrthoDBiEOG091G0C6I
PhylomeDBiQ14181
TreeFamiTF314249

Family and domain databases

InterProiView protein in InterPro
IPR007185 DNA_pol_alpha/epsilon_bsu
IPR016722 DNA_pol_alpha_bsu
IPR013627 Pol_alpha_B_N
PANTHERiPTHR23061 PTHR23061, 1 hit
PfamiView protein in Pfam
PF04042 DNA_pol_E_B, 1 hit
PF08418 Pol_alpha_B_N, 1 hit
PIRSFiPIRSF018300 DNA_pol_alph_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14181-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSASAQQLAE ELQIFGLDCE EALIEKLVEL CVQYGQNEEG MVGELIAFCT
60 70 80 90 100
STHKVGLTSE ILNSFEHEFL SKRLSKARHS TCKDSGHAGA RDIVSIQELI
110 120 130 140 150
EVEEEEEILL NSYTTPSKGS QKRAISTPET PLTKRSVSTR SPHQLLSPSS
160 170 180 190 200
FSPSATPSQK YNSRSNRGEV VTSFGLAQGV SWSGRGGAGN ISLKVLGCPE
210 220 230 240 250
ALTGSYKSMF QKLPDIREVL TCKIEELGSE LKEHYKIEAF TPLLAPAQEP
260 270 280 290 300
VTLLGQIGCD SNGKLNNKSV ILEGDREHSS GAQIPVDLSE LKEYSLFPGQ
310 320 330 340 350
VVIMEGINTT GRKLVATKLY EGVPLPFYQP TEEDADFEQS MVLVACGPYT
360 370 380 390 400
TSDSITYDPL LDLIAVINHD RPDVCILFGP FLDAKHEQVE NCLLTSPFED
410 420 430 440 450
IFKQCLRTII EGTRSSGSHL VFVPSLRDVH HEPVYPQPPF SYSDLSREDK
460 470 480 490 500
KQVQFVSEPC SLSINGVIFG LTSTDLLFHL GAEEISSSSG TSDRFSRILK
510 520 530 540 550
HILTQRSYYP LYPPQEDMAI DYESFYVYAQ LPVTPDVLII PSELRYFVKD
560 570 580 590
VLGCVCVNPG RLTKGQVGGT FARLYLRRPA ADGAERQSPC IAVQVVRI
Length:598
Mass (Da):65,948
Last modified:February 7, 2006 - v2
Checksum:iF5CBD7E022ADDDBF
GO
Isoform 2 (identifier: Q14181-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-208: Missing.
     550-598: DVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI → VGLNSAFSQKHQNPVFDFPF

Note: No experimental confirmation available.
Show »
Length:361
Mass (Da):40,579
Checksum:i53B1AE982B92ED81
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDR7H0YDR7_HUMAN
DNA polymerase alpha subunit B
POLA2
261Annotation score:
E9PIQ6E9PIQ6_HUMAN
DNA polymerase alpha subunit B
POLA2
146Annotation score:
E9PQ99E9PQ99_HUMAN
DNA polymerase alpha subunit B
POLA2
37Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti383 – 384DA → ES in AAA16459 (PubMed:8223465).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033896583G → R. Corresponds to variant dbSNP:rs487989Ensembl.1
Natural variantiVAR_033897588S → N. Corresponds to variant dbSNP:rs7123885Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566081 – 208Missing in isoform 2. 1 PublicationAdd BLAST208
Alternative sequenceiVSP_056609550 – 598DVLGC…QVVRI → VGLNSAFSQKHQNPVFDFPF in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24559 mRNA Translation: AAA16459.1
AK297842 mRNA Translation: BAG60176.1
CR456737 mRNA Translation: CAG33018.1
AP000944 Genomic DNA No translation available.
BC002990 mRNA Translation: AAH02990.1
BC001347 mRNA Translation: AAH01347.1
CCDSiCCDS8098.1 [Q14181-1]
PIRiS39621
RefSeqiNP_002680.2, NM_002689.3 [Q14181-1]
UniGeneiHs.201897

Genome annotation databases

EnsembliENST00000265465; ENSP00000265465; ENSG00000014138 [Q14181-1]
GeneIDi23649
KEGGihsa:23649
UCSCiuc001odj.4 human [Q14181-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24559 mRNA Translation: AAA16459.1
AK297842 mRNA Translation: BAG60176.1
CR456737 mRNA Translation: CAG33018.1
AP000944 Genomic DNA No translation available.
BC002990 mRNA Translation: AAH02990.1
BC001347 mRNA Translation: AAH01347.1
CCDSiCCDS8098.1 [Q14181-1]
PIRiS39621
RefSeqiNP_002680.2, NM_002689.3 [Q14181-1]
UniGeneiHs.201897

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KEBNMR-A1-78[»]
4E2IX-ray5.001/2/3/4/5/6/7/8/9/U/W1-78[»]
4Y97X-ray2.51A/C/E/G1-598[»]
5EXRX-ray3.60D/H2-598[»]
ProteinModelPortaliQ14181
SMRiQ14181
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117176, 63 interactors
ComplexPortaliCPX-2087 DNA polymerase alpha:primase complex
CORUMiQ14181
IntActiQ14181, 36 interactors
MINTiQ14181
STRINGi9606.ENSP00000265465

Chemistry databases

ChEMBLiCHEMBL2363042
DrugBankiDB00851 Dacarbazine

PTM databases

iPTMnetiQ14181
PhosphoSitePlusiQ14181

Polymorphism and mutation databases

BioMutaiPOLA2
DMDMi90110415

Proteomic databases

EPDiQ14181
MaxQBiQ14181
PaxDbiQ14181
PeptideAtlasiQ14181
PRIDEiQ14181
ProteomicsDBi59900

Protocols and materials databases

DNASUi23649
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265465; ENSP00000265465; ENSG00000014138 [Q14181-1]
GeneIDi23649
KEGGihsa:23649
UCSCiuc001odj.4 human [Q14181-1]

Organism-specific databases

CTDi23649
DisGeNETi23649
EuPathDBiHostDB:ENSG00000014138.8
GeneCardsiPOLA2
HGNCiHGNC:30073 POLA2
HPAiHPA037570
neXtProtiNX_Q14181
OpenTargetsiENSG00000014138
PharmGKBiPA411
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1625 Eukaryota
COG5214 LUCA
GeneTreeiENSGT00390000016784
HOGENOMiHOG000007382
HOVERGENiHBG055628
InParanoidiQ14181
KOiK02321
OMAiYLVEQRH
OrthoDBiEOG091G0C6I
PhylomeDBiQ14181
TreeFamiTF314249

Enzyme and pathway databases

ReactomeiR-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-174411 Polymerase switching on the C-strand of the telomere
R-HSA-174430 Telomere C-strand synthesis initiation
R-HSA-68952 DNA replication initiation
R-HSA-68962 Activation of the pre-replicative complex
R-HSA-69091 Polymerase switching
R-HSA-69166 Removal of the Flap Intermediate
R-HSA-69183 Processive synthesis on the lagging strand

Miscellaneous databases

ChiTaRSiPOLA2 human
EvolutionaryTraceiQ14181
GeneWikiiPOLA2
GenomeRNAii23649
PROiPR:Q14181

Gene expression databases

BgeeiENSG00000014138 Expressed in 168 organ(s), highest expression level in embryo
CleanExiHS_POLA2
ExpressionAtlasiQ14181 baseline and differential
GenevisibleiQ14181 HS

Family and domain databases

InterProiView protein in InterPro
IPR007185 DNA_pol_alpha/epsilon_bsu
IPR016722 DNA_pol_alpha_bsu
IPR013627 Pol_alpha_B_N
PANTHERiPTHR23061 PTHR23061, 1 hit
PfamiView protein in Pfam
PF04042 DNA_pol_E_B, 1 hit
PF08418 Pol_alpha_B_N, 1 hit
PIRSFiPIRSF018300 DNA_pol_alph_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDPOA2_HUMAN
AccessioniPrimary (citable) accession number: Q14181
Secondary accession number(s): B4DNB4, Q9BPV3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: February 7, 2006
Last modified: November 7, 2018
This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again