Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 177 (02 Jun 2021)
Sequence version 2 (07 Feb 2006)
Previous versions | rss
Add a publicationFeedback
Protein

DNA polymerase alpha subunit B

Gene

POLA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Accessory subunit of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which plays an essential role in the initiation of DNA synthesis (PubMed:9705292).

During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1, an accessory subunit POLA2 and two primase subunits, the catalytic subunit PRIM1 and the regulatory subunit PRIM2) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1 (By similarity).

The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands (By similarity).

These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively (By similarity).

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA replication

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q14181

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-113501, Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-174411, Polymerase switching on the C-strand of the telomere
R-HSA-174430, Telomere C-strand synthesis initiation
R-HSA-68952, DNA replication initiation
R-HSA-68962, Activation of the pre-replicative complex
R-HSA-69091, Polymerase switching
R-HSA-69166, Removal of the Flap Intermediate
R-HSA-69183, Processive synthesis on the lagging strand

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q14181

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA polymerase alpha subunit B
Alternative name(s):
DNA polymerase alpha 70 kDa subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:POLA2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30073, POLA2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14181

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000014138.8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23649

Open Targets

More...
OpenTargetsi
ENSG00000014138

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA411

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q14181, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2363042

Drug and drug target database

More...
DrugBanki
DB00851, Dacarbazine

DrugCentral

More...
DrugCentrali
Q14181

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
POLA2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
90110415

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001940351 – 598DNA polymerase alpha subunit BAdd BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei126PhosphoserineCombined sources1
Modified residuei127PhosphothreonineCombined sources1
Modified residuei130PhosphothreonineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Modified residuei147PhosphoserineCombined sources1
Modified residuei152PhosphoserineCombined sources1
Modified residuei154PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in a cell cycle-dependent manner, in G2/M phase.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14181

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14181

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14181

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14181

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14181

PeptideAtlas

More...
PeptideAtlasi
Q14181

PRoteomics IDEntifications database

More...
PRIDEi
Q14181

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
4684
59900 [Q14181-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14181

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14181

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q14181

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000014138, Expressed in tonsil and 184 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14181, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14181, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000014138, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the alpha DNA polymerase complex (also known as the alpha DNA polymerase-primase complex) consisting of four subunits: the catalytic subunit POLA1, the regulatory subunit POLA2, and primase complex subunits PRIM1 and PRIM2 respectively (PubMed:9705292). Within the complex, POLA1 directly interacts with PRIM2/p58 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
117176, 75 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-2087, DNA polymerase alpha:primase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q14181

Protein interaction database and analysis system

More...
IntActi
Q14181, 62 interactors

Molecular INTeraction database

More...
MINTi
Q14181

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000265465

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q14181, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q14181

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14181

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14181

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni112 – 167DisorderedSequence analysisAdd BLAST56

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal 240 amino acids are sufficient to mediate complex formation.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1625, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016784

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_014923_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14181

Identification of Orthologs from Complete Genome Data

More...
OMAi
PFLDIEH

Database of Orthologous Groups

More...
OrthoDBi
513979at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14181

TreeFam database of animal gene trees

More...
TreeFami
TF314249

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.8.530, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007185, DNA_pol_a/d/e_bsu
IPR043034, DNA_pol_alpha_B_N_sf
IPR016722, DNA_pol_alpha_bsu
IPR013627, Pol_alpha_B_N

The PANTHER Classification System

More...
PANTHERi
PTHR23061, PTHR23061, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04042, DNA_pol_E_B, 1 hit
PF08418, Pol_alpha_B_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF018300, DNA_pol_alph_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14181-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSASAQQLAE ELQIFGLDCE EALIEKLVEL CVQYGQNEEG MVGELIAFCT
60 70 80 90 100
STHKVGLTSE ILNSFEHEFL SKRLSKARHS TCKDSGHAGA RDIVSIQELI
110 120 130 140 150
EVEEEEEILL NSYTTPSKGS QKRAISTPET PLTKRSVSTR SPHQLLSPSS
160 170 180 190 200
FSPSATPSQK YNSRSNRGEV VTSFGLAQGV SWSGRGGAGN ISLKVLGCPE
210 220 230 240 250
ALTGSYKSMF QKLPDIREVL TCKIEELGSE LKEHYKIEAF TPLLAPAQEP
260 270 280 290 300
VTLLGQIGCD SNGKLNNKSV ILEGDREHSS GAQIPVDLSE LKEYSLFPGQ
310 320 330 340 350
VVIMEGINTT GRKLVATKLY EGVPLPFYQP TEEDADFEQS MVLVACGPYT
360 370 380 390 400
TSDSITYDPL LDLIAVINHD RPDVCILFGP FLDAKHEQVE NCLLTSPFED
410 420 430 440 450
IFKQCLRTII EGTRSSGSHL VFVPSLRDVH HEPVYPQPPF SYSDLSREDK
460 470 480 490 500
KQVQFVSEPC SLSINGVIFG LTSTDLLFHL GAEEISSSSG TSDRFSRILK
510 520 530 540 550
HILTQRSYYP LYPPQEDMAI DYESFYVYAQ LPVTPDVLII PSELRYFVKD
560 570 580 590
VLGCVCVNPG RLTKGQVGGT FARLYLRRPA ADGAERQSPC IAVQVVRI
Length:598
Mass (Da):65,948
Last modified:February 7, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF5CBD7E022ADDDBF
GO
Isoform 2 (identifier: Q14181-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-208: Missing.
     550-598: DVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI → VGLNSAFSQKHQNPVFDFPF

Show »
Length:361
Mass (Da):40,579
Checksum:i53B1AE982B92ED81
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDR7H0YDR7_HUMAN
DNA polymerase alpha subunit B
POLA2
261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIQ6E9PIQ6_HUMAN
DNA polymerase alpha subunit B
POLA2
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQ99E9PQ99_HUMAN
DNA polymerase alpha subunit B
POLA2
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti383 – 384DA → ES in AAA16459 (PubMed:8223465).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033896583G → R. Corresponds to variant dbSNP:rs487989Ensembl.1
Natural variantiVAR_033897588S → N. Corresponds to variant dbSNP:rs7123885Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566081 – 208Missing in isoform 2. 1 PublicationAdd BLAST208
Alternative sequenceiVSP_056609550 – 598DVLGC…QVVRI → VGLNSAFSQKHQNPVFDFPF in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L24559 mRNA Translation: AAA16459.1
AK297842 mRNA Translation: BAG60176.1
CR456737 mRNA Translation: CAG33018.1
AP000944 Genomic DNA No translation available.
BC002990 mRNA Translation: AAH02990.1
BC001347 mRNA Translation: AAH01347.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8098.1 [Q14181-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S39621

NCBI Reference Sequences

More...
RefSeqi
NP_002680.2, NM_002689.3 [Q14181-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265465; ENSP00000265465; ENSG00000014138 [Q14181-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23649

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23649

UCSC genome browser

More...
UCSCi
uc001odj.4, human [Q14181-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24559 mRNA Translation: AAA16459.1
AK297842 mRNA Translation: BAG60176.1
CR456737 mRNA Translation: CAG33018.1
AP000944 Genomic DNA No translation available.
BC002990 mRNA Translation: AAH02990.1
BC001347 mRNA Translation: AAH01347.1
CCDSiCCDS8098.1 [Q14181-1]
PIRiS39621
RefSeqiNP_002680.2, NM_002689.3 [Q14181-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KEBNMR-A1-78[»]
4E2IX-ray5.001/2/3/4/5/6/7/8/9/U/W1-78[»]
4Y97X-ray2.51A/C/E/G1-598[»]
5EXRX-ray3.60D/H2-598[»]
BMRBiQ14181
SMRiQ14181
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117176, 75 interactors
ComplexPortaliCPX-2087, DNA polymerase alpha:primase complex
CORUMiQ14181
IntActiQ14181, 62 interactors
MINTiQ14181
STRINGi9606.ENSP00000265465

Chemistry databases

ChEMBLiCHEMBL2363042
DrugBankiDB00851, Dacarbazine
DrugCentraliQ14181

PTM databases

iPTMnetiQ14181
PhosphoSitePlusiQ14181
SwissPalmiQ14181

Genetic variation databases

BioMutaiPOLA2
DMDMi90110415

Proteomic databases

EPDiQ14181
jPOSTiQ14181
MassIVEiQ14181
MaxQBiQ14181
PaxDbiQ14181
PeptideAtlasiQ14181
PRIDEiQ14181
ProteomicsDBi4684
59900 [Q14181-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29737, 281 antibodies

The DNASU plasmid repository

More...
DNASUi
23649

Genome annotation databases

EnsembliENST00000265465; ENSP00000265465; ENSG00000014138 [Q14181-1]
GeneIDi23649
KEGGihsa:23649
UCSCiuc001odj.4, human [Q14181-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23649
DisGeNETi23649

GeneCards: human genes, protein and diseases

More...
GeneCardsi
POLA2
HGNCiHGNC:30073, POLA2
HPAiENSG00000014138, Low tissue specificity
neXtProtiNX_Q14181
OpenTargetsiENSG00000014138
PharmGKBiPA411
VEuPathDBiHostDB:ENSG00000014138.8

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1625, Eukaryota
GeneTreeiENSGT00390000016784
HOGENOMiCLU_014923_3_1_1
InParanoidiQ14181
OMAiPFLDIEH
OrthoDBi513979at2759
PhylomeDBiQ14181
TreeFamiTF314249

Enzyme and pathway databases

PathwayCommonsiQ14181
ReactomeiR-HSA-113501, Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-174411, Polymerase switching on the C-strand of the telomere
R-HSA-174430, Telomere C-strand synthesis initiation
R-HSA-68952, DNA replication initiation
R-HSA-68962, Activation of the pre-replicative complex
R-HSA-69091, Polymerase switching
R-HSA-69166, Removal of the Flap Intermediate
R-HSA-69183, Processive synthesis on the lagging strand
SIGNORiQ14181

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23649, 719 hits in 1000 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
POLA2, human
EvolutionaryTraceiQ14181

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
POLA2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23649
PharosiQ14181, Tbio

Protein Ontology

More...
PROi
PR:Q14181
RNActiQ14181, protein

Gene expression databases

BgeeiENSG00000014138, Expressed in tonsil and 184 other tissues
ExpressionAtlasiQ14181, baseline and differential
GenevisibleiQ14181, HS

Family and domain databases

Gene3Di1.10.8.530, 1 hit
InterProiView protein in InterPro
IPR007185, DNA_pol_a/d/e_bsu
IPR043034, DNA_pol_alpha_B_N_sf
IPR016722, DNA_pol_alpha_bsu
IPR013627, Pol_alpha_B_N
PANTHERiPTHR23061, PTHR23061, 1 hit
PfamiView protein in Pfam
PF04042, DNA_pol_E_B, 1 hit
PF08418, Pol_alpha_B_N, 1 hit
PIRSFiPIRSF018300, DNA_pol_alph_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDPOA2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14181
Secondary accession number(s): B4DNB4, Q9BPV3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: February 7, 2006
Last modified: June 2, 2021
This is version 177 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again