Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAGUK p55 subfamily member 2

Gene

MPP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Postsynaptic MAGUK scaffold protein that links CADM1 cell adhesion molecules to core components of the postsynaptic density (By similarity). In CA1 pyramidal neurons, required for synaptic KCNN2-containing channel function and long-term potentiation expression (By similarity). Seems to negatively regulate SRC function in epithelial cells (PubMed:19665017).By similarity1 Publication

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
MAGUK p55 subfamily member 2
Alternative name(s):
Discs large homolog 2
Protein MPP2
Gene namesi
Name:MPP2Imported
Synonyms:DLG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000108852.14
HGNCiHGNC:7220 MPP2
MIMi600723 gene
neXtProtiNX_Q14168

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi363Y → A: Enhances association with the cytoskeleton. Diminishes the inhibitory effect on SRC. 1 Publication1
Mutagenesisi363Y → D: Enhances association with the cytoskeleton. 1 Publication1

Organism-specific databases

DisGeNETi4355
OpenTargetsiENSG00000108852
PharmGKBiPA30925

Polymorphism and mutation databases

DMDMi290457681

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945731 – 576MAGUK p55 subfamily member 2Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei42PhosphoserineBy similarity1
Modified residuei141PhosphothreonineCombined sources1
Modified residuei145PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by SRC.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ14168
MaxQBiQ14168
PaxDbiQ14168
PeptideAtlasiQ14168
PRIDEiQ14168
ProteomicsDBi59895
59896 [Q14168-2]
59897 [Q14168-3]
TopDownProteomicsiQ14168-2 [Q14168-2]

PTM databases

iPTMnetiQ14168
PhosphoSitePlusiQ14168
SwissPalmiQ14168

Expressioni

Gene expression databases

BgeeiENSG00000108852 Expressed in 155 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_DLG2
HS_MPP2
ExpressionAtlasiQ14168 baseline and differential

Organism-specific databases

HPAiHPA026486

Interactioni

Subunit structurei

Can homomultimerise. Interacts with CACNG2. Interacts (via the SH3-Guanylate kinase-like sub-module) with DLG4/PSD95 and DLGAP1/GKAP. Interacts (via the PDZ domain) with CADM1 (via C-terminus) (By similarity). Interacts with KCNN2/SK2 (via N-terminal domain) (By similarity). Interacts with SRC (PubMed:19665017).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
LIN7AO149103EBI-10181752,EBI-2513988

Protein-protein interaction databases

BioGridi110495, 22 interactors
IntActiQ14168, 12 interactors
MINTiQ14168
STRINGi9606.ENSP00000269095

Structurei

Secondary structure

1576
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14168
SMRiQ14168
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14168

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 60L27 1PROSITE-ProRule annotationAdd BLAST53
Domaini84 – 142L27 2PROSITE-ProRule annotationAdd BLAST59
Domaini185 – 240PDZPROSITE-ProRule annotationAdd BLAST56
Domaini249 – 317SH3PROSITE-ProRule annotationAdd BLAST69
Domaini374 – 561Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST188

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0609 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000233034
HOVERGENiHBG001858
InParanoidiQ14168
PhylomeDBiQ14168
TreeFamiTF314263

Family and domain databases

CDDicd12037 SH3_MPP2, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035602 MPP2_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 2 hits
PF00595 PDZ, 1 hit
PF07653 SH3_2, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 16 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q14168-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVAATNSET AMQQVLDNLG SLPSATGAAE LDLIFLRGIM ESPIVRSLAK
60 70 80 90 100
VIMVLWFMQQ NVFVPMKYML KYFGAHERLE ETKLEAVRDN NLELVQEILR
110 120 130 140 150
DLAHVAEQSS TAAELAHILQ EPHFQSLLET HDSVASKTYE TPPPSPGLDP
160 170 180 190 200
TFSNQPVPPD AVRMVGIRKT AGEHLGVTFR VEGGELVIAR ILHGGMVAQQ
210 220 230 240 250
GLLHVGDIIK EVNGQPVGSD PRALQELLRN ASGSVILKIL PSYQEPHLPR
260 270 280 290 300
QVFVKCHFDY DPARDSLIPC KEAGLRFNAG DLLQIVNQDD ANWWQACHVE
310 320 330 340 350
GGSAGLIPSQ LLEEKRKAFV KRDLELTPNS GTLCGSLSGK KKKRMMYLTT
360 370 380 390 400
KNAEFDRHEL LIYEEVARMP PFRRKTLVLI GAQGVGRRSL KNKLIMWDPD
410 420 430 440 450
RYGTTVPYTS RRPKDSEREG QGYSFVSRGE MEADVRAGRY LEHGEYEGNL
460 470 480 490 500
YGTRIDSIRG VVAAGKVCVL DVNPQAVKVL RTAEFVPYVV FIEAPDFETL
510 520 530 540 550
RAMNRAALES GISTKQLTEA DLRRTVEESS RIQRGYGHYF DLCLVNSNLE
560 570
RTFRELQTAM EKLRTEPQWV PVSWVY
Length:576
Mass (Da):64,581
Last modified:March 2, 2010 - v3
Checksum:iA08E858EA646A305
GO
Isoform 2 (identifier: Q14168-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-74: Missing.

Show »
Length:552
Mass (Da):61,585
Checksum:i81BBB336B3C9DA89
GO
Isoform 3 (identifier: Q14168-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MPVAATNSET → MAGSPGSGVSLEGISLESSEEAELQRE
     51-74: Missing.

Show »
Length:569
Mass (Da):63,315
Checksum:i40FE59BE6B6D998C
GO
Isoform 4 (identifier: Q14168-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM
     51-74: Missing.

Show »
Length:597
Mass (Da):66,802
Checksum:i2D04EAC57B8C7934
GO
Isoform 5 (identifier: Q14168-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-163: Missing.

Show »
Length:413
Mass (Da):46,518
Checksum:i6F9ADB21579E5A2F
GO
Isoform 6 (identifier: Q14168-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.
     51-74: Missing.

Show »
Length:541
Mass (Da):60,512
Checksum:i83D4E1782E4D3C99
GO

Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DH75A0A0C4DH75_HUMAN
MAGUK p55 subfamily member 2
MPP2
597Annotation score:
B4DZ84B4DZ84_HUMAN
cDNA FLJ52373, highly similar to MA...
MPP2
541Annotation score:
A0A0A0MRU0A0A0A0MRU0_HUMAN
MAGUK p55 subfamily member 2
MPP2
569Annotation score:
D3DX49D3DX49_HUMAN
Membrane protein, palmitoylated 2 (...
MPP2 hCG_30288
576Annotation score:
D3DX48D3DX48_HUMAN
MAGUK p55 subfamily member 2
MPP2 hCG_30288
552Annotation score:
A0A0D9SFF8A0A0D9SFF8_HUMAN
MAGUK p55 subfamily member 2
MPP2
573Annotation score:
E5RIU3E5RIU3_HUMAN
MAGUK p55 subfamily member 2
MPP2
151Annotation score:
E5RK44E5RK44_HUMAN
MAGUK p55 subfamily member 2
MPP2
143Annotation score:
E5RI32E5RI32_HUMAN
MAGUK p55 subfamily member 2
MPP2
148Annotation score:
E5RJK0E5RJK0_HUMAN
MAGUK p55 subfamily member 2
MPP2
140Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti80E → G in CAI56746 (PubMed:17974005).Curated1
Sequence conflicti104 – 105HV → QL in CAA58067 (PubMed:7590743).Curated2
Sequence conflicti104 – 105HV → QL in BAD97280 (PubMed:11230166).Curated2
Sequence conflicti104 – 105HV → QL in CAB66489 (Ref. 5) Curated2
Sequence conflicti104 – 105HV → QL in CAI56746 (PubMed:17974005).Curated2
Sequence conflicti104 – 105HV → QL in AAH30287 (PubMed:15489334).Curated2
Sequence conflicti104 – 105HV → QL in BAG61302 (PubMed:14702039).Curated2
Sequence conflicti104 – 105HV → QL in BAH12204 (PubMed:14702039).Curated2
Sequence conflicti242S → N in CAA58067 (PubMed:7590743).Curated1
Sequence conflicti531R → C in BAG57760 (PubMed:14702039).Curated1
Sequence conflicti554R → C in BAG61302 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0551361 – 163Missing in isoform 5. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_0551371 – 11Missing in isoform 6. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0229511 – 10MPVAATNSET → MAGSPGSGVSLEGISLESSE EAELQRE in isoform 3. 1 Publication10
Alternative sequenceiVSP_0551381M → MSWAPPPQVGQNLRSQTVLR ILNGMEDLMWVAMEERRFRA LASFTM in isoform 4. 1 Publication1
Alternative sequenceiVSP_00315651 – 74Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 5 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82895 mRNA Translation: CAA58067.1
AL136554 mRNA Translation: CAB66489.1
AK294564 mRNA Translation: BAG57760.1
AK295858 mRNA Translation: BAH12204.1
AK299286 mRNA Translation: BAG61302.1
CR936598 mRNA Translation: CAI56746.1
AK223560 mRNA Translation: BAD97280.1
AC007993 Genomic DNA No translation available.
BC030287 mRNA Translation: AAH30287.1
CCDSiCCDS11471.1 [Q14168-2]
CCDS62206.1 [Q14168-5]
CCDS62207.1 [Q14168-6]
CCDS62208.1 [Q14168-3]
CCDS62209.1 [Q14168-1]
CCDS62210.1 [Q14168-4]
PIRiA57653
RefSeqiNP_001265299.1, NM_001278370.1
NP_001265300.1, NM_001278371.1
NP_001265301.1, NM_001278372.1
NP_001265302.1, NM_001278373.1
NP_001265303.1, NM_001278374.1 [Q14168-5]
NP_001265304.1, NM_001278375.1
NP_001265305.2, NM_001278376.2
NP_001265310.1, NM_001278381.1
NP_005365.4, NM_005374.4
UniGeneiHs.514208

Genome annotation databases

EnsembliENST00000520305; ENSP00000428136; ENSG00000108852 [Q14168-5]
GeneIDi4355
KEGGihsa:4355
UCSCiuc010win.3 human [Q14168-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMPP2_HUMAN
AccessioniPrimary (citable) accession number: Q14168
Secondary accession number(s): B4DGE9
, B4DRJ0, B7Z3G8, E7EV80, E7EV91, E7EX01, Q53ES9, Q5CZB9, Q9BQJ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: September 12, 2018
This is version 171 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again