Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAGUK p55 subfamily member 2

Gene

MPP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Postsynaptic MAGUK scaffold protein that links CADM1 cell adhesion molecules to core components of the postsynaptic density (By similarity). In CA1 pyramidal neurons, required for synaptic KCNN2-containing channel function and long-term potentiation expression (By similarity). Seems to negatively regulate SRC function in epithelial cells (PubMed:19665017).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MAGUK p55 subfamily member 2
Alternative name(s):
Discs large homolog 2
Protein MPP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPP2Imported
Synonyms:DLG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000108852.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7220 MPP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600723 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14168

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi363Y → A: Enhances association with the cytoskeleton. Diminishes the inhibitory effect on SRC. 1 Publication1
Mutagenesisi363Y → D: Enhances association with the cytoskeleton. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
4355

Open Targets

More...
OpenTargetsi
ENSG00000108852

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30925

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
290457681

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945731 – 576MAGUK p55 subfamily member 2Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei42PhosphoserineBy similarity1
Modified residuei141PhosphothreonineCombined sources1
Modified residuei145PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by SRC.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14168

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14168

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14168

PeptideAtlas

More...
PeptideAtlasi
Q14168

PRoteomics IDEntifications database

More...
PRIDEi
Q14168

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59895
59896 [Q14168-2]
59897 [Q14168-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q14168-2 [Q14168-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14168

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14168

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q14168

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000108852 Expressed in 155 organ(s), highest expression level in C1 segment of cervical spinal cord

CleanEx database of gene expression profiles

More...
CleanExi
HS_DLG2
HS_MPP2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14168 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026486

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can homomultimerise. Interacts with CACNG2. Interacts (via the SH3-Guanylate kinase-like sub-module) with DLG4/PSD95 and DLGAP1/GKAP. Interacts (via the PDZ domain) with CADM1 (via C-terminus) (By similarity). Interacts with KCNN2/SK2 (via N-terminal domain) (By similarity). Interacts with SRC (PubMed:19665017).By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
LIN7AO149103EBI-10181752,EBI-2513988

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110495, 22 interactors

Protein interaction database and analysis system

More...
IntActi
Q14168, 12 interactors

Molecular INTeraction database

More...
MINTi
Q14168

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000269095

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1576
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14168

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14168

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14168

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 60L27 1PROSITE-ProRule annotationAdd BLAST53
Domaini84 – 142L27 2PROSITE-ProRule annotationAdd BLAST59
Domaini185 – 240PDZPROSITE-ProRule annotationAdd BLAST56
Domaini249 – 317SH3PROSITE-ProRule annotationAdd BLAST69
Domaini374 – 561Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST188

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0609 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155348

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233034

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001858

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14168

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14168

TreeFam database of animal gene trees

More...
TreeFami
TF314263

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12037 SH3_MPP2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035602 MPP2_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 2 hits
PF00595 PDZ, 1 hit
PF07653 SH3_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14168-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVAATNSET AMQQVLDNLG SLPSATGAAE LDLIFLRGIM ESPIVRSLAK
60 70 80 90 100
VIMVLWFMQQ NVFVPMKYML KYFGAHERLE ETKLEAVRDN NLELVQEILR
110 120 130 140 150
DLAHVAEQSS TAAELAHILQ EPHFQSLLET HDSVASKTYE TPPPSPGLDP
160 170 180 190 200
TFSNQPVPPD AVRMVGIRKT AGEHLGVTFR VEGGELVIAR ILHGGMVAQQ
210 220 230 240 250
GLLHVGDIIK EVNGQPVGSD PRALQELLRN ASGSVILKIL PSYQEPHLPR
260 270 280 290 300
QVFVKCHFDY DPARDSLIPC KEAGLRFNAG DLLQIVNQDD ANWWQACHVE
310 320 330 340 350
GGSAGLIPSQ LLEEKRKAFV KRDLELTPNS GTLCGSLSGK KKKRMMYLTT
360 370 380 390 400
KNAEFDRHEL LIYEEVARMP PFRRKTLVLI GAQGVGRRSL KNKLIMWDPD
410 420 430 440 450
RYGTTVPYTS RRPKDSEREG QGYSFVSRGE MEADVRAGRY LEHGEYEGNL
460 470 480 490 500
YGTRIDSIRG VVAAGKVCVL DVNPQAVKVL RTAEFVPYVV FIEAPDFETL
510 520 530 540 550
RAMNRAALES GISTKQLTEA DLRRTVEESS RIQRGYGHYF DLCLVNSNLE
560 570
RTFRELQTAM EKLRTEPQWV PVSWVY
Length:576
Mass (Da):64,581
Last modified:March 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA08E858EA646A305
GO
Isoform 2 (identifier: Q14168-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-74: Missing.

Show »
Length:552
Mass (Da):61,585
Checksum:i81BBB336B3C9DA89
GO
Isoform 3 (identifier: Q14168-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MPVAATNSET → MAGSPGSGVSLEGISLESSEEAELQRE
     51-74: Missing.

Show »
Length:569
Mass (Da):63,315
Checksum:i40FE59BE6B6D998C
GO
Isoform 4 (identifier: Q14168-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM
     51-74: Missing.

Show »
Length:597
Mass (Da):66,802
Checksum:i2D04EAC57B8C7934
GO
Isoform 5 (identifier: Q14168-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-163: Missing.

Show »
Length:413
Mass (Da):46,518
Checksum:i6F9ADB21579E5A2F
GO
Isoform 6 (identifier: Q14168-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.
     51-74: Missing.

Show »
Length:541
Mass (Da):60,512
Checksum:i83D4E1782E4D3C99
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DH75A0A0C4DH75_HUMAN
MAGUK p55 subfamily member 2
MPP2
597Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DZ84B4DZ84_HUMAN
cDNA FLJ52373, highly similar to MA...
MPP2
541Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3DX49D3DX49_HUMAN
Membrane protein, palmitoylated 2 (...
MPP2 hCG_30288
576Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRU0A0A0A0MRU0_HUMAN
MAGUK p55 subfamily member 2
MPP2
569Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3DX48D3DX48_HUMAN
MAGUK p55 subfamily member 2
MPP2 hCG_30288
552Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SFF8A0A0D9SFF8_HUMAN
MAGUK p55 subfamily member 2
MPP2
573Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RI32E5RI32_HUMAN
MAGUK p55 subfamily member 2
MPP2
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVY2A0A087WVY2_HUMAN
MAGUK p55 subfamily member 2
MPP2
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJK0E5RJK0_HUMAN
MAGUK p55 subfamily member 2
MPP2
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIU3E5RIU3_HUMAN
MAGUK p55 subfamily member 2
MPP2
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti80E → G in CAI56746 (PubMed:17974005).Curated1
Sequence conflicti104 – 105HV → QL in CAA58067 (PubMed:7590743).Curated2
Sequence conflicti104 – 105HV → QL in BAD97280 (PubMed:11230166).Curated2
Sequence conflicti104 – 105HV → QL in CAB66489 (Ref. 5) Curated2
Sequence conflicti104 – 105HV → QL in CAI56746 (PubMed:17974005).Curated2
Sequence conflicti104 – 105HV → QL in AAH30287 (PubMed:15489334).Curated2
Sequence conflicti104 – 105HV → QL in BAG61302 (PubMed:14702039).Curated2
Sequence conflicti104 – 105HV → QL in BAH12204 (PubMed:14702039).Curated2
Sequence conflicti242S → N in CAA58067 (PubMed:7590743).Curated1
Sequence conflicti531R → C in BAG57760 (PubMed:14702039).Curated1
Sequence conflicti554R → C in BAG61302 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0551361 – 163Missing in isoform 5. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_0551371 – 11Missing in isoform 6. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0229511 – 10MPVAATNSET → MAGSPGSGVSLEGISLESSE EAELQRE in isoform 3. 1 Publication10
Alternative sequenceiVSP_0551381M → MSWAPPPQVGQNLRSQTVLR ILNGMEDLMWVAMEERRFRA LASFTM in isoform 4. 1 Publication1
Alternative sequenceiVSP_00315651 – 74Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 5 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X82895 mRNA Translation: CAA58067.1
AL136554 mRNA Translation: CAB66489.1
AK294564 mRNA Translation: BAG57760.1
AK295858 mRNA Translation: BAH12204.1
AK299286 mRNA Translation: BAG61302.1
CR936598 mRNA Translation: CAI56746.1
AK223560 mRNA Translation: BAD97280.1
AC007993 Genomic DNA No translation available.
BC030287 mRNA Translation: AAH30287.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11471.1 [Q14168-2]
CCDS62206.1 [Q14168-5]
CCDS62207.1 [Q14168-6]
CCDS62208.1 [Q14168-3]
CCDS62209.1 [Q14168-1]
CCDS62210.1 [Q14168-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57653

NCBI Reference Sequences

More...
RefSeqi
NP_001265299.1, NM_001278370.1
NP_001265300.1, NM_001278371.1
NP_001265301.1, NM_001278372.1
NP_001265302.1, NM_001278373.1
NP_001265303.1, NM_001278374.1 [Q14168-5]
NP_001265304.1, NM_001278375.1
NP_001265305.2, NM_001278376.2
NP_001265310.1, NM_001278381.1
NP_005365.4, NM_005374.4

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.514208

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000520305; ENSP00000428136; ENSG00000108852 [Q14168-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4355

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4355

UCSC genome browser

More...
UCSCi
uc010win.3 human [Q14168-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82895 mRNA Translation: CAA58067.1
AL136554 mRNA Translation: CAB66489.1
AK294564 mRNA Translation: BAG57760.1
AK295858 mRNA Translation: BAH12204.1
AK299286 mRNA Translation: BAG61302.1
CR936598 mRNA Translation: CAI56746.1
AK223560 mRNA Translation: BAD97280.1
AC007993 Genomic DNA No translation available.
BC030287 mRNA Translation: AAH30287.1
CCDSiCCDS11471.1 [Q14168-2]
CCDS62206.1 [Q14168-5]
CCDS62207.1 [Q14168-6]
CCDS62208.1 [Q14168-3]
CCDS62209.1 [Q14168-1]
CCDS62210.1 [Q14168-4]
PIRiA57653
RefSeqiNP_001265299.1, NM_001278370.1
NP_001265300.1, NM_001278371.1
NP_001265301.1, NM_001278372.1
NP_001265302.1, NM_001278373.1
NP_001265303.1, NM_001278374.1 [Q14168-5]
NP_001265304.1, NM_001278375.1
NP_001265305.2, NM_001278376.2
NP_001265310.1, NM_001278381.1
NP_005365.4, NM_005374.4
UniGeneiHs.514208

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E7KNMR-A163-240[»]
ProteinModelPortaliQ14168
SMRiQ14168
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110495, 22 interactors
IntActiQ14168, 12 interactors
MINTiQ14168
STRINGi9606.ENSP00000269095

PTM databases

iPTMnetiQ14168
PhosphoSitePlusiQ14168
SwissPalmiQ14168

Polymorphism and mutation databases

DMDMi290457681

Proteomic databases

EPDiQ14168
MaxQBiQ14168
PaxDbiQ14168
PeptideAtlasiQ14168
PRIDEiQ14168
ProteomicsDBi59895
59896 [Q14168-2]
59897 [Q14168-3]
TopDownProteomicsiQ14168-2 [Q14168-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000520305; ENSP00000428136; ENSG00000108852 [Q14168-5]
GeneIDi4355
KEGGihsa:4355
UCSCiuc010win.3 human [Q14168-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4355
DisGeNETi4355
EuPathDBiHostDB:ENSG00000108852.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MPP2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0013870
HGNCiHGNC:7220 MPP2
HPAiHPA026486
MIMi600723 gene
neXtProtiNX_Q14168
OpenTargetsiENSG00000108852
PharmGKBiPA30925

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0609 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000155348
HOGENOMiHOG000233034
HOVERGENiHBG001858
InParanoidiQ14168
PhylomeDBiQ14168
TreeFamiTF314263

Miscellaneous databases

EvolutionaryTraceiQ14168

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MPP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4355

Protein Ontology

More...
PROi
PR:Q14168

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000108852 Expressed in 155 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_DLG2
HS_MPP2
ExpressionAtlasiQ14168 baseline and differential

Family and domain databases

CDDicd12037 SH3_MPP2, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035602 MPP2_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 2 hits
PF00595 PDZ, 1 hit
PF07653 SH3_2, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14168
Secondary accession number(s): B4DGE9
, B4DRJ0, B7Z3G8, E7EV80, E7EV91, E7EX01, Q53ES9, Q5CZB9, Q9BQJ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: December 5, 2018
This is version 173 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again