Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (18 Sep 2019)
Sequence version 2 (03 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DNA repair-scaffolding protein

Gene

SPIDR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in DNA double-strand break (DBS) repair via homologous recombination (HR). Serves as a scaffolding protein that helps to promote the recruitment of DNA-processing enzymes like the helicase BLM and recombinase RAD51 to site of DNA damage, and hence contributes to maintain genomic integrity.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA damage, DNA recombination, DNA repair

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA repair-scaffolding protein
Alternative name(s):
Scaffolding protein involved in DNA repair
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPIDR
Synonyms:KIAA0146
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28971 SPIDR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615384 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14159

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23514

MalaCards human disease database

More...
MalaCardsi
SPIDR

Open Targets

More...
OpenTargetsi
ENSG00000164808

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
243 46,XX gonadal dysgenesis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671636

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPIDR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
115502235

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002517201 – 915DNA repair-scaffolding proteinAdd BLAST915

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14159

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14159

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14159

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14159

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14159

PeptideAtlas

More...
PeptideAtlasi
Q14159

PRoteomics IDEntifications database

More...
PRIDEi
Q14159

ProteomicsDB human proteome resource

More...
ProteomicsDBi
4082
5709
59872 [Q14159-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14159

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14159

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in vascular endothelial cells treated with IL4. Up-regulated upon human SARS coronavirus infection.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164808 Expressed in 224 organ(s), highest expression level in left lobe of thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14159 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14159 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027201
HPA041582

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex, at least composed of BLM, RAD51 and SPIDR; the complex formation is mediated by SPIDR.

Interacts (via C-terminal region) with BLM; the interaction is direct.

Interacts with RAD51; the interaction is direct.

Interacts (via the C-terminal region) with FIGNL1 (via N-terminal one-half region); the interaction is direct.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117061, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q14159, 2 interactors

Molecular INTeraction database

More...
MINTi
Q14159

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000297423

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni151 – 450Necessary for interaction with RAD511 PublicationAdd BLAST300

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGEG Eukaryota
ENOG410Y7PZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014654

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070204

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14159

KEGG Orthology (KO)

More...
KOi
K22806

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECTMQVA

Database of Orthologous Groups

More...
OrthoDBi
326023at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14159

TreeFam database of animal gene trees

More...
TreeFami
TF333292

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028026 DUF4502
IPR028032 DUF4503

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14950 DUF4502, 1 hit
PF14951 DUF4503, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14159-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRGSRARGS KRKRSWNTEC PSFPGERPLQ VRRAGLRTAG AAASLSEAWL
60 70 80 90 100
RCGEGFQNTS GNPSLTAEEK TITEKHLELC PRPKQETTTS KSTSGLTDIT
110 120 130 140 150
WSSSGSDLSD EDKTLSQLQR DELQFIDWEI DSDRAEASDC DEFEDDEGAV
160 170 180 190 200
EISDCASCAS NQSLTSDEKL SELPKPSSIE ILEYSSDSEK EDDLENVLLI
210 220 230 240 250
DSESPHKYHV QFASDARQIM ERLIDPRTKS TETILHTPQK PTAKFPRTPE
260 270 280 290 300
NSAKKKLLRG GLAERLNGLQ NRERSAISLW RHQCISYQKT LSGRKSGVLT
310 320 330 340 350
VKILELHEEC AMQVAMCEQL LGSPATSSSQ SVAPRPGAGL KVLFTKETAG
360 370 380 390 400
YLRGRPQDTV RIFPPWQKLI IPSGSCPVIL NTYFCEKVVA KEDSEKTCEV
410 420 430 440 450
YCPDIPLPRR SISLAQMFVI KGLTNNSPEI QVVCSGVATT GTAWTHGHKE
460 470 480 490 500
AKQRIPTSTP LRDSLLDVVE SQGAASWPGA GVRVVVQRVY SLPSRDSTRG
510 520 530 540 550
QQGASSGHTD PAGTRACLLV QDACGMFGEV HLEFTMSKAR QLEGKSCSLV
560 570 580 590 600
GMKVLQKVTR GRTAGIFSLI DTLWPPAIPL KTPGRDQPCE EIKTHLPPPA
610 620 630 640 650
LCYILTAHPN LGQIDIIDED PIYKLYQPPV TRCLRDILQM NDLGTRCSFY
660 670 680 690 700
ATVIYQKPQL KSLLLLEQRE IWLLVTDVTL QTKEERDPRL PKTLLVYVAP
710 720 730 740 750
LCVLGSEVLE ALAGAAPHSL FFKDALRDQG RIVCAERTVL LLQKPLLSVV
760 770 780 790 800
SGASSCELPG PVMLDSLDSA TPVNSICSVQ GTVVGVDEST AFSWPVCDMC
810 820 830 840 850
GNGRLEQRPE DRGAFSCGDC SRVVTSPVLK RHLQVFLDCR SRPQCRVKVK
860 870 880 890 900
LLQRSISSLL RFAAGEDGSY EVKSVLGKEV GLLNCFVQSV TAHPTSCIGL
910
EEIELLSAGG ASAEH
Length:915
Mass (Da):100,316
Last modified:October 3, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDA35068B5849135D
GO
Isoform 2 (identifier: Q14159-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MPRGSRARGS...HLELCPRPKQ → MAQVWRRVSEHFWES

Note: No experimental confirmation available.
Show »
Length:845
Mass (Da):92,871
Checksum:i828B4F1FE824611E
GO
Isoform 3 (identifier: Q14159-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MPRGSRARGSKRKRSWNTECPSFPGERPLQVRRAGLRTAGAAASLSEAWLRCGEGFQNTSGNP → MAQ
     851-915: LLQRSISSLL...LSAGGASAEH → VGARPEHART...MWLQGWWWWW

Note: No experimental confirmation available.
Show »
Length:876
Mass (Da):96,870
Checksum:iD14E3FB7C3628469
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3KP42B3KP42_HUMAN
DNA repair-scaffolding protein
SPIDR
390Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBC9H0YBC9_HUMAN
DNA repair-scaffolding protein
SPIDR
497Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIU7E5RIU7_HUMAN
DNA repair-scaffolding protein
SPIDR
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGV8E5RGV8_HUMAN
DNA repair-scaffolding protein
SPIDR
132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DMX9B4DMX9_HUMAN
DNA repair-scaffolding protein
SPIDR
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EVI9E7EVI9_HUMAN
DNA repair-scaffolding protein
SPIDR
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJJ2E5RJJ2_HUMAN
DNA repair-scaffolding protein
SPIDR
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHG3E5RHG3_HUMAN
DNA repair-scaffolding protein
SPIDR
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIB8E5RIB8_HUMAN
DNA repair-scaffolding protein
SPIDR
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFY2E5RFY2_HUMAN
DNA repair-scaffolding protein
SPIDR
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA09767 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566521 – 85MPRGS…PRPKQ → MAQVWRRVSEHFWES in isoform 2. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_0566531 – 63MPRGS…TSGNP → MAQ in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_056654851 – 915LLQRS…ASAEH → VGARPEHARTPSSLQHSEEL RSEECPRKGSGVVKLFCPVR NRPPDQLHWIGGNRASECRR GLCRTLAVAAGSVNFAMWLQ GWWWWW in isoform 3. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D63480 mRNA Translation: BAA09767.1 Different initiation.
AK294275 mRNA Translation: BAG57563.1
AK303579 mRNA Translation: BAG64598.1
AC023991 Genomic DNA No translation available.
AC024451 Genomic DNA No translation available.
AC024649 Genomic DNA No translation available.
AC104995 Genomic DNA No translation available.
AC142471 Genomic DNA No translation available.
AC233269 Genomic DNA No translation available.
BC015561 mRNA Translation: AAH15561.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43737.1 [Q14159-1]
CCDS64890.1 [Q14159-3]
CCDS64891.1 [Q14159-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001073863.1, NM_001080394.3 [Q14159-1]
NP_001269845.1, NM_001282916.1 [Q14159-2]
NP_001269848.1, NM_001282919.1 [Q14159-3]
XP_016868760.1, XM_017013271.1 [Q14159-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297423; ENSP00000297423; ENSG00000164808 [Q14159-1]
ENST00000518074; ENSP00000429487; ENSG00000164808 [Q14159-3]
ENST00000541342; ENSP00000444061; ENSG00000164808 [Q14159-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23514

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23514

UCSC genome browser

More...
UCSCi
uc003xqd.5 human [Q14159-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63480 mRNA Translation: BAA09767.1 Different initiation.
AK294275 mRNA Translation: BAG57563.1
AK303579 mRNA Translation: BAG64598.1
AC023991 Genomic DNA No translation available.
AC024451 Genomic DNA No translation available.
AC024649 Genomic DNA No translation available.
AC104995 Genomic DNA No translation available.
AC142471 Genomic DNA No translation available.
AC233269 Genomic DNA No translation available.
BC015561 mRNA Translation: AAH15561.2
CCDSiCCDS43737.1 [Q14159-1]
CCDS64890.1 [Q14159-3]
CCDS64891.1 [Q14159-2]
RefSeqiNP_001073863.1, NM_001080394.3 [Q14159-1]
NP_001269845.1, NM_001282916.1 [Q14159-2]
NP_001269848.1, NM_001282919.1 [Q14159-3]
XP_016868760.1, XM_017013271.1 [Q14159-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi117061, 4 interactors
IntActiQ14159, 2 interactors
MINTiQ14159
STRINGi9606.ENSP00000297423

PTM databases

iPTMnetiQ14159
PhosphoSitePlusiQ14159

Polymorphism and mutation databases

BioMutaiSPIDR
DMDMi115502235

Proteomic databases

EPDiQ14159
jPOSTiQ14159
MassIVEiQ14159
MaxQBiQ14159
PaxDbiQ14159
PeptideAtlasiQ14159
PRIDEiQ14159
ProteomicsDBi4082
5709
59872 [Q14159-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23514
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297423; ENSP00000297423; ENSG00000164808 [Q14159-1]
ENST00000518074; ENSP00000429487; ENSG00000164808 [Q14159-3]
ENST00000541342; ENSP00000444061; ENSG00000164808 [Q14159-2]
GeneIDi23514
KEGGihsa:23514
UCSCiuc003xqd.5 human [Q14159-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23514
DisGeNETi23514

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPIDR
HGNCiHGNC:28971 SPIDR
HPAiHPA027201
HPA041582
MalaCardsiSPIDR
MIMi615384 gene
neXtProtiNX_Q14159
OpenTargetsiENSG00000164808
Orphaneti243 46,XX gonadal dysgenesis
PharmGKBiPA142671636

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGEG Eukaryota
ENOG410Y7PZ LUCA
GeneTreeiENSGT00390000014654
HOGENOMiHOG000070204
InParanoidiQ14159
KOiK22806
OMAiECTMQVA
OrthoDBi326023at2759
PhylomeDBiQ14159
TreeFamiTF333292

Enzyme and pathway databases

ReactomeiR-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPIDR human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23514

Pharos

More...
Pharosi
Q14159

Protein Ontology

More...
PROi
PR:Q14159

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164808 Expressed in 224 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ14159 baseline and differential
GenevisibleiQ14159 HS

Family and domain databases

InterProiView protein in InterPro
IPR028026 DUF4502
IPR028032 DUF4503
PfamiView protein in Pfam
PF14950 DUF4502, 1 hit
PF14951 DUF4503, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPIDR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14159
Secondary accession number(s): B4DFV2, B4E0Y6, Q96BI5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: September 18, 2019
This is version 123 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again