Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 181 (07 Apr 2021)
Sequence version 2 (27 Jun 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Ubiquitin-associated protein 2-like

Gene

UBAP2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT-HSCs). Required for efficient formation of stress granules (PubMed:29395067).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q14157

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q14157

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin-associated protein 2-likeCurated
Alternative name(s):
Protein NICE-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBAP2LImported
Synonyms:KIAA0144, NICE4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29877, UBAP2L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616472, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14157

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000143569.18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9898

Open Targets

More...
OpenTargetsi
ENSG00000143569

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134883839

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q14157, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4295819

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBAP2L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
109940042

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002110201 – 1087Ubiquitin-associated protein 2-likeAdd BLAST1087

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei187Asymmetric dimethylarginineCombined sources1
Modified residuei190Asymmetric dimethylarginineCombined sources1
Modified residuei356PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1
Modified residuei410PhosphoserineCombined sources1
Modified residuei416PhosphoserineCombined sources1
Modified residuei425PhosphothreonineCombined sources1
Modified residuei439PhosphoserineCombined sources1
Modified residuei454PhosphoserineCombined sources1
Modified residuei467PhosphoserineCombined sources1
Modified residuei470PhosphoserineCombined sources1
Modified residuei471PhosphoserineCombined sources1
Modified residuei477PhosphoserineCombined sources1
Modified residuei604PhosphoserineCombined sources1
Modified residuei605PhosphoserineCombined sources1
Modified residuei608PhosphoserineCombined sources1
Modified residuei609PhosphoserineCombined sources1
Modified residuei852PhosphoserineCombined sources1
Modified residuei859PhosphoserineCombined sources1
Isoform 4 (identifier: Q14157-4)
Modified residuei962Omega-N-methylarginineCombined sources1
Modified residuei969N6-acetyllysineCombined sources1
Isoform 2 (identifier: Q14157-1)
Modified residuei969Omega-N-methylarginineCombined sources1
Modified residuei976N6-acetyllysineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated.

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-599
CPTAC-600

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14157

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14157

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14157

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14157

PeptideAtlas

More...
PeptideAtlasi
Q14157

PRoteomics IDEntifications database

More...
PRIDEi
Q14157

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
59867 [Q14157-2]
59868 [Q14157-1]
59869 [Q14157-3]
59870 [Q14157-4]
59871 [Q14157-5]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2895, 1 O-Linked glycan (2 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q14157, 11 sites, 1 O-linked glycan (9 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14157

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q14157

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14157

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143569, Expressed in left lobe of thyroid gland and 241 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14157, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14157, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000143569, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BMI1 (PubMed:25185265).

Part of a complex consisting of UBAP2L, BMI1 and RNF2(PubMed:25185265).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115227, 199 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q14157

Protein interaction database and analysis system

More...
IntActi
Q14157, 34 interactors

Molecular INTeraction database

More...
MINTi
Q14157

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000389445

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q14157, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14157

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini49 – 89UBAPROSITE-ProRule annotationAdd BLAST41

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QPRH, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003453

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009850_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14157

Identification of Orthologs from Complete Genome Data

More...
OMAi
VKTEWEV

Database of Orthologous Groups

More...
OrthoDBi
234795at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14157

TreeFam database of animal gene trees

More...
TreeFami
TF328468

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015940, UBA
IPR009060, UBA-like_sf
IPR022166, UBAP2/Lig

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12478, DUF3697, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00165, UBA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934, SSF46934, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50030, UBA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14157-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMTSVGTNRA RGNWEQPQNQ NQTQHKQRPQ ATAEQIRLAQ MISDHNDADF
60 70 80 90 100
EEKVKQLIDI TGKNQDECVI ALHDCNGDVN RAINVLLEGN PDTHSWEMVG
110 120 130 140 150
KKKGVSGQKD GGQTESNEEG KENRDRDRDY SRRRGGPPRR GRGASRGREF
160 170 180 190 200
RGQENGLDGT KSGGPSGRGT ERGRRGRGRG RGGSGRRGGR FSAQGMGTFN
210 220 230 240 250
PADYAEPANT DDNYGNSSGN TWNNTGHFEP DDGTSAWRTA TEEWGTEDWN
260 270 280 290 300
EDLSETKIFT ASNVSSVPLP AENVTITAGQ RIDLAVLLGK TPSTMENDSS
310 320 330 340 350
NLDPSQAPSL AQPLVFSNSK QTAISQPASG NTFSHHSMVS MLGKGFGDVG
360 370 380 390 400
EAKGGSTTGS QFLEQFKTAQ ALAQLAAQHS QSGSTTTSSW DMGSTTQSPS
410 420 430 440 450
LVQYDLKNPS DSAVHSPFTK RQAFTPSSTM MEVFLQEKSP AVATSTAAPP
460 470 480 490 500
PPSSPLPSKS TSAPQMSPGS SDNQSSSPQP AQQKLKQQKK KASLTSKIPA
510 520 530 540 550
LAVEMPGSAD ISGLNLQFGA LQFGSEPVLS DYESTPTTSA SSSQAPSSLY
560 570 580 590 600
TSTASESSST ISSNQSQESG YQSGPIQSTT YTSQNNAQGP LYEQRSTQTR
610 620 630 640 650
RYPSSISSSP QKDLTQAKNG FSSVQATQLQ TTQSVEGATG SAVKSDSPST
660 670 680 690 700
SSIPPLNETV SAASLLTTTN QHSSSLGGLS HSEEIPNTTT TQHSSTLSTQ
710 720 730 740 750
QNTLSSSTSS GRTSTSTLLH TSVESEANLH SSSSTFSTTS STVSAPPPVV
760 770 780 790 800
SVSSSLNSGS SLGLSLGSNS TVTASTRSSV ATTSGKAPPN LPPGVPPLLP
810 820 830 840 850
NPYIMAPGLL HAYPPQVYGY DDLQMLQTRF PLDYYSIPFP TPTTPLTGRD
860 870 880 890 900
GSLASNPYSG DLTKFGRGDA SSPAPATTLA QPQQNQTQTH HTTQQTFLNP
910 920 930 940 950
ALPPGYSYTS LPYYTGVPGL PSTFQYGPAV FPVAPTSSKQ HGVNVSVNAS
960 970 980 990 1000
ATPFQQPSGY GSHGYNTGVS VTSSNTGVPD ISGSVYSKTQ QSFEKQGFHS
1010 1020 1030 1040 1050
GTPAASFNLP SALGSGGPIN PATAAAYPPA PFMHILTPHQ QPHSQILHHH
1060 1070 1080
LQQDGQTGSG QRSQTSSIPQ KPQTNKSAYN SYSWGAN
Length:1,087
Mass (Da):114,535
Last modified:June 27, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFED18847387AA1F5
GO
Isoform 2 (identifier: Q14157-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     969-1087: VSVTSSNTGV...AYNSYSWGAN → RKYPPPYKHFWTAES

Show »
Length:983
Mass (Da):103,930
Checksum:i50579CFA293EEA68
GO
Isoform 3 (identifier: Q14157-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1087: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → DILNFVDDQLGE

Show »
Length:1,068
Mass (Da):112,580
Checksum:i86703186E7D5FC73
GO
Isoform 4 (identifier: Q14157-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     143-150: GASRGREF → V
     969-1087: VSVTSSNTGV...AYNSYSWGAN → RKYPPPYKHFWTAES

Show »
Length:976
Mass (Da):103,168
Checksum:iBF593BEA38DF9579
GO
Isoform 5 (identifier: Q14157-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1055-1055: G → GQLPYLQMILCCQRQQEE

Show »
Length:1,104
Mass (Da):116,640
Checksum:iA361FC99B94E0988
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W726F8W726_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
1,079Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VU77Q5VU77_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
350Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VU80Q5VU80_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VU78Q5VU78_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
280Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VU79Q5VU79_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
265Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VU81Q5VU81_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y5H6H0Y5H6_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
383Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2T8H7C2T8_HUMAN
Ubiquitin-associated protein 2-like
UBAP2L
399Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAB65100 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti91P → S in BAG64560 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026829482Q → H. Corresponds to variant dbSNP:rs17849745Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038235143 – 150GASRGREF → V in isoform 4. 1 Publication8
Alternative sequenceiVSP_019417969 – 1087VSVTS…SWGAN → RKYPPPYKHFWTAES in isoform 2 and isoform 4. 2 PublicationsAdd BLAST119
Alternative sequenceiVSP_0421671055G → GQLPYLQMILCCQRQQEE in isoform 5. 1 Publication1
Alternative sequenceiVSP_0217281057 – 1087TGSGQ…SWGAN → DILNFVDDQLGE in isoform 3. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D63478 mRNA Translation: BAA09765.1
AK303533 mRNA Translation: BAG64560.1
AL590431 Genomic DNA No translation available.
BC003170 mRNA Translation: AAH03170.1
AJ243668 mRNA Translation: CAB65099.1
AJ243670 mRNA Translation: CAB65101.2
AJ243669 mRNA Translation: CAB65100.2 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1063.1 [Q14157-2]
CCDS44229.1 [Q14157-1]
CCDS72925.1 [Q14157-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001120792.1, NM_001127320.2 [Q14157-1]
NP_001274744.1, NM_001287815.1 [Q14157-4]
NP_001274745.1, NM_001287816.1
NP_055662.3, NM_014847.3 [Q14157-2]
XP_005245731.1, XM_005245674.1
XP_011508518.1, XM_011510216.1
XP_016858467.1, XM_017002978.1
XP_016858468.1, XM_017002979.1
XP_016858475.1, XM_017002986.1
XP_016858476.1, XM_017002987.1
XP_016858478.1, XM_017002989.1
XP_016858479.1, XM_017002990.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343815; ENSP00000345308; ENSG00000143569 [Q14157-1]
ENST00000361546; ENSP00000355343; ENSG00000143569 [Q14157-2]
ENST00000428931; ENSP00000389445; ENSG00000143569 [Q14157-2]
ENST00000613315; ENSP00000478447; ENSG00000143569 [Q14157-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9898

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9898

UCSC genome browser

More...
UCSCi
uc001fep.5, human [Q14157-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63478 mRNA Translation: BAA09765.1
AK303533 mRNA Translation: BAG64560.1
AL590431 Genomic DNA No translation available.
BC003170 mRNA Translation: AAH03170.1
AJ243668 mRNA Translation: CAB65099.1
AJ243670 mRNA Translation: CAB65101.2
AJ243669 mRNA Translation: CAB65100.2 Frameshift.
CCDSiCCDS1063.1 [Q14157-2]
CCDS44229.1 [Q14157-1]
CCDS72925.1 [Q14157-4]
RefSeqiNP_001120792.1, NM_001127320.2 [Q14157-1]
NP_001274744.1, NM_001287815.1 [Q14157-4]
NP_001274745.1, NM_001287816.1
NP_055662.3, NM_014847.3 [Q14157-2]
XP_005245731.1, XM_005245674.1
XP_011508518.1, XM_011510216.1
XP_016858467.1, XM_017002978.1
XP_016858468.1, XM_017002979.1
XP_016858475.1, XM_017002986.1
XP_016858476.1, XM_017002987.1
XP_016858478.1, XM_017002989.1
XP_016858479.1, XM_017002990.1

3D structure databases

SMRiQ14157
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115227, 199 interactors
CORUMiQ14157
IntActiQ14157, 34 interactors
MINTiQ14157
STRINGi9606.ENSP00000389445

Chemistry databases

ChEMBLiCHEMBL4295819

PTM databases

GlyConnecti2895, 1 O-Linked glycan (2 sites)
GlyGeniQ14157, 11 sites, 1 O-linked glycan (9 sites)
iPTMnetiQ14157
MetOSiteiQ14157
PhosphoSitePlusiQ14157

Genetic variation databases

BioMutaiUBAP2L
DMDMi109940042

Proteomic databases

CPTACiCPTAC-599
CPTAC-600
EPDiQ14157
jPOSTiQ14157
MassIVEiQ14157
PaxDbiQ14157
PeptideAtlasiQ14157
PRIDEiQ14157
ProteomicsDBi59867 [Q14157-2]
59868 [Q14157-1]
59869 [Q14157-3]
59870 [Q14157-4]
59871 [Q14157-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34148, 184 antibodies

Genome annotation databases

EnsembliENST00000343815; ENSP00000345308; ENSG00000143569 [Q14157-1]
ENST00000361546; ENSP00000355343; ENSG00000143569 [Q14157-2]
ENST00000428931; ENSP00000389445; ENSG00000143569 [Q14157-2]
ENST00000613315; ENSP00000478447; ENSG00000143569 [Q14157-4]
GeneIDi9898
KEGGihsa:9898
UCSCiuc001fep.5, human [Q14157-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9898
DisGeNETi9898

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBAP2L
HGNCiHGNC:29877, UBAP2L
HPAiENSG00000143569, Low tissue specificity
MIMi616472, gene
neXtProtiNX_Q14157
OpenTargetsiENSG00000143569
PharmGKBiPA134883839
VEuPathDBiHostDB:ENSG00000143569.18

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QPRH, Eukaryota
GeneTreeiENSGT00390000003453
HOGENOMiCLU_009850_0_0_1
InParanoidiQ14157
OMAiVKTEWEV
OrthoDBi234795at2759
PhylomeDBiQ14157
TreeFamiTF328468

Enzyme and pathway databases

PathwayCommonsiQ14157
SIGNORiQ14157

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9898, 73 hits in 1008 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UBAP2L, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UBAP2L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9898
PharosiQ14157, Tbio

Protein Ontology

More...
PROi
PR:Q14157
RNActiQ14157, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143569, Expressed in left lobe of thyroid gland and 241 other tissues
ExpressionAtlasiQ14157, baseline and differential
GenevisibleiQ14157, HS

Family and domain databases

InterProiView protein in InterPro
IPR015940, UBA
IPR009060, UBA-like_sf
IPR022166, UBAP2/Lig
PfamiView protein in Pfam
PF12478, DUF3697, 1 hit
SMARTiView protein in SMART
SM00165, UBA, 1 hit
SUPFAMiSSF46934, SSF46934, 1 hit
PROSITEiView protein in PROSITE
PS50030, UBA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBP2L_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14157
Secondary accession number(s): B4E0U8
, Q5VU75, Q5VU76, Q9BTU3, Q9UGL2, Q9UGL3, Q9UGL4, Q9UGL5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: June 27, 2006
Last modified: April 7, 2021
This is version 181 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again