Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nidogen-2

Gene

NID2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3000157 Laminin interactions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nidogen-2
Short name:
NID-2
Alternative name(s):
Osteonidogen
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NID2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000087303.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13389 NID2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605399 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14112

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Basement membrane, Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22795

Open Targets

More...
OpenTargetsi
ENSG00000087303

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31626

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NID2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
290457669

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 301 PublicationAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000767131 – 1375Nidogen-2Add BLAST1345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi417N-linked (GlcNAc...) asparagineCurated1
Glycosylationi658N-linked (GlcNAc...) asparagineCurated1
Glycosylationi693N-linked (GlcNAc...) asparagineCurated1
Glycosylationi703N-linked (GlcNAc...) asparagineCurated1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi763 ↔ 776By similarity
Disulfide bondi770 ↔ 786By similarity
Disulfide bondi788 ↔ 799By similarity
Disulfide bondi805 ↔ 818By similarity
Disulfide bondi812 ↔ 827By similarity
Disulfide bondi829 ↔ 842By similarity
Disulfide bondi852 ↔ 867By similarity
Disulfide bondi859 ↔ 877By similarity
Disulfide bondi879 ↔ 890By similarity
Disulfide bondi896 ↔ 907By similarity
Disulfide bondi901 ↔ 916By similarity
Disulfide bondi918 ↔ 929By similarity
Disulfide bondi940 ↔ 963By similarity
Disulfide bondi974 ↔ 981By similarity
Disulfide bondi983 ↔ 1005By similarity
Disulfide bondi1019 ↔ 1043By similarity
Disulfide bondi1054 ↔ 1061By similarity
Disulfide bondi1063 ↔ 1084By similarity
Glycosylationi1124N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1308Omega-N-methylarginineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Highly N- and O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Methylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14112

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14112

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14112

PeptideAtlas

More...
PeptideAtlasi
Q14112

PRoteomics IDEntifications database

More...
PRIDEi
Q14112

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59817
59818 [Q14112-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1569

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14112

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14112

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000087303 Expressed in 189 organ(s), highest expression level in pigmented layer of retina

CleanEx database of gene expression profiles

More...
CleanExi
HS_NID2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14112 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14112 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052460
HPA058772

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with LAMA2 (By similarity). Interacts with COL13A1.By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116476, 38 interactors

Protein interaction database and analysis system

More...
IntActi
Q14112, 4 interactors

Molecular INTeraction database

More...
MINTi
Q14112

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000216286

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14112

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14112

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini108 – 273NIDOPROSITE-ProRule annotationAdd BLAST166
Domaini484 – 524EGF-like 1PROSITE-ProRule annotationAdd BLAST41
Domaini528 – 758Nidogen G2 beta-barrelPROSITE-ProRule annotationAdd BLAST231
Domaini759 – 800EGF-like 2PROSITE-ProRule annotationAdd BLAST42
Domaini801 – 843EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini848 – 891EGF-like 4PROSITE-ProRule annotationAdd BLAST44
Domaini892 – 930EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST39
Domaini937 – 1005Thyroglobulin type-1 1PROSITE-ProRule annotationAdd BLAST69
Domaini1016 – 1084Thyroglobulin type-1 2PROSITE-ProRule annotationAdd BLAST69
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1154 – 1197LDL-receptor class B 1Add BLAST44
Repeati1198 – 1240LDL-receptor class B 2Add BLAST43
Repeati1241 – 1285LDL-receptor class B 3Add BLAST45
Repeati1286 – 1327LDL-receptor class B 4Add BLAST42
Repeati1329 – 1373LDL-receptor class B 5Add BLAST45

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMYX Eukaryota
ENOG4111DVZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157901

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000072712

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006498

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14112

KEGG Orthology (KO)

More...
KOi
K06826

Identification of Orthologs from Complete Genome Data

More...
OMAi
RHAFCTD

Database of Orthologous Groups

More...
OrthoDBi
EOG091G030P

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14112

TreeFam database of animal gene trees

More...
TreeFami
TF320666

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00255 nidG2, 1 hit
cd00191 TY, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.120.10.30, 1 hit
4.10.800.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR006605 G2_nidogen/fibulin_G2F
IPR009017 GFP
IPR009030 Growth_fac_rcpt_cys_sf
IPR000033 LDLR_classB_rpt
IPR003886 NIDO_dom
IPR000716 Thyroglobulin_1
IPR036857 Thyroglobulin_1_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12662 cEGF, 1 hit
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 1 hit
PF07474 G2F, 1 hit
PF00058 Ldl_recept_b, 2 hits
PF06119 NIDO, 1 hit
PF00086 Thyroglobulin_1, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 4 hits
SM00682 G2F, 1 hit
SM00135 LY, 5 hits
SM00539 NIDO, 1 hit
SM00211 TY, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54511 SSF54511, 1 hit
SSF57184 SSF57184, 1 hit
SSF57610 SSF57610, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS01186 EGF_2, 4 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 2 hits
PS51120 LDLRB, 4 hits
PS51220 NIDO, 1 hit
PS50993 NIDOGEN_G2, 1 hit
PS00484 THYROGLOBULIN_1_1, 2 hits
PS51162 THYROGLOBULIN_1_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14112-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGDRVAGRP VLSSLPVLLL LPLLMLRAAA LHPDELFPHG ESWGDQLLQE
60 70 80 90 100
GDDESSAVVK LANPLHFYEA RFSNLYVGTN GIISTQDFPR ETQYVDYDFP
110 120 130 140 150
TDFPAIAPFL ADIDTSHGRG RVLYREDTSP AVLGLAARYV RAGFPRSARF
160 170 180 190 200
TPTHAFLATW EQVGAYEEVK RGALPSGELN TFQAVLASDG SDSYALFLYP
210 220 230 240 250
ANGLQFLGTR PKESYNVQLQ LPARVGFCRG EADDLKSEGP YFSLTSTEQS
260 270 280 290 300
VKNLYQLSNL GIPGVWAFHI GSTSPLDNVR PAAVGDLSAA HSSVPLGRSF
310 320 330 340 350
SHATALESDY NEDNLDYYDV NEEEAEYLPG EPEEALNGHS SIDVSFQSKV
360 370 380 390 400
DTKPLEESST LDPHTKEGTS LGEVGGPDLK GQVEPWDERE TRSPAPPEVD
410 420 430 440 450
RDSLAPSWET PPPYPENGSI QPYPDGGPVP SEMDVPPAHP EEEIVLRSYP
460 470 480 490 500
ASGHTTPLSR GTYEVGLEDN IGSNTEVFTY NAANKETCEH NHRQCSRHAF
510 520 530 540 550
CTDYATGFCC HCQSKFYGNG KHCLPEGAPH RVNGKVSGHL HVGHTPVHFT
560 570 580 590 600
DVDLHAYIVG NDGRAYTAIS HIPQPAAQAL LPLTPIGGLF GWLFALEKPG
610 620 630 640 650
SENGFSLAGA AFTHDMEVTF YPGEETVRIT QTAEGLDPEN YLSIKTNIQG
660 670 680 690 700
QVPYVSANFT AHISPYKELY HYSDSTVTST SSRDYSLTFG AINQTWSYRI
710 720 730 740 750
HQNITYQVCR HAPRHPSFPT TQQLNVDRVF ALYNDEERVL RFAVTNQIGP
760 770 780 790 800
VKEDSDPTPG NPCYDGSHMC DTTARCHPGT GVDYTCECAS GYQGDGRNCV
810 820 830 840 850
DENECATGFH RCGPNSVCIN LPGSYRCECR SGYEFADDRH TCILITPPAN
860 870 880 890 900
PCEDGSHTCA PAGQARCVHH GGSTFSCACL PGYAGDGHQC TDVDECSENR
910 920 930 940 950
CHPAATCYNT PGSFSCRCQP GYYGDGFQCI PDSTSSLTPC EQQQRHAQAQ
960 970 980 990 1000
YAYPGARFHI PQCDEQGNFL PLQCHGSTGF CWCVDPDGHE VPGTQTPPGS
1010 1020 1030 1040 1050
TPPHCGPSPE PTQRPPTICE RWRENLLEHY GGTPRDDQYV PQCDDLGHFI
1060 1070 1080 1090 1100
PLQCHGKSDF CWCVDKDGRE VQGTRSQPGT TPACIPTVAP PMVRPTPRPD
1110 1120 1130 1140 1150
VTPPSVGTFL LYTQGQQIGY LPLNGTRLQK DAAKTLLSLH GSIIVGIDYD
1160 1170 1180 1190 1200
CRERMVYWTD VAGRTISRAG LELGAEPETI VNSGLISPEG LAIDHIRRTM
1210 1220 1230 1240 1250
YWTDSVLDKI ESALLDGSER KVLFYTDLVN PRAIAVDPIR GNLYWTDWNR
1260 1270 1280 1290 1300
EAPKIETSSL DGENRRILIN TDIGLPNGLT FDPFSKLLCW ADAGTKKLEC
1310 1320 1330 1340 1350
TLPDGTGRRV IQNNLKYPFS IVSYADHFYH TDWRRDGVVS VNKHSGQFTD
1360 1370
EYLPEQRSHL YGITAVYPYC PTGRK
Length:1,375
Mass (Da):151,254
Last modified:March 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i198D1F4E286A53E2
GO
Isoform 2 (identifier: Q14112-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-59: Missing.
     844-892: LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD → Y

Note: No experimental confirmation available.
Show »
Length:1,274
Mass (Da):140,866
Checksum:iC6E3D787DB40235B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WZP6A0A087WZP6_HUMAN
Nidogen-2
NID2
969Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJV3H0YJV3_HUMAN
Nidogen-2
NID2
644Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA13087 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.Curated
The sequence BAA24112 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti44G → W in BAA13087 (Ref. 2) Curated1
Sequence conflicti44G → W in BAA24112 (Ref. 3) Curated1
Sequence conflicti700I → T in BAG62181 (PubMed:14702039).Curated1
Sequence conflicti1242N → D in BAF84341 (PubMed:14702039).Curated1
Sequence conflicti1245W → R in BAF84341 (PubMed:14702039).Curated1
Sequence conflicti1249N → D in BAF84341 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06285022P → Q4 PublicationsCorresponds to variant dbSNP:rs3920038Ensembl.1
Natural variantiVAR_055767313D → G. Corresponds to variant dbSNP:rs17124969Ensembl.1
Natural variantiVAR_055768354P → H. Corresponds to variant dbSNP:rs35657569Ensembl.1
Natural variantiVAR_062851453G → D1 PublicationCorresponds to variant dbSNP:rs2101919Ensembl.1
Natural variantiVAR_055769529P → S. Corresponds to variant dbSNP:rs17831525Ensembl.1
Natural variantiVAR_062852656S → P4 PublicationsCorresponds to variant dbSNP:rs3742536Ensembl.1
Natural variantiVAR_055770726V → M. Corresponds to variant dbSNP:rs35147930Ensembl.1
Natural variantiVAR_062853760G → VCombined sources4 PublicationsCorresponds to variant dbSNP:rs2273430Ensembl.1
Natural variantiVAR_055771775R → Q. Corresponds to variant dbSNP:rs10134590Ensembl.1
Natural variantiVAR_055772830R → Q. Corresponds to variant dbSNP:rs7144523Ensembl.1
Natural variantiVAR_055773866R → Q. Corresponds to variant dbSNP:rs28507587Ensembl.1
Natural variantiVAR_0358361238P → S in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1305582875Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0387797 – 59Missing in isoform 2. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_038780844 – 892LITPP…HQCTD → Y in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ223500 mRNA Translation: CAA11418.1
D86425 mRNA Translation: BAA13087.1 Frameshift.
AB009799 Genomic DNA Translation: BAA24112.1 Frameshift.
AK300462 mRNA Translation: BAG62181.1
AK291652 mRNA Translation: BAF84341.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9706.1 [Q14112-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
G00043

NCBI Reference Sequences

More...
RefSeqi
NP_031387.3, NM_007361.3 [Q14112-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.369840

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000216286; ENSP00000216286; ENSG00000087303 [Q14112-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22795

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22795

UCSC genome browser

More...
UCSCi
uc001wzo.4 human [Q14112-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223500 mRNA Translation: CAA11418.1
D86425 mRNA Translation: BAA13087.1 Frameshift.
AB009799 Genomic DNA Translation: BAA24112.1 Frameshift.
AK300462 mRNA Translation: BAG62181.1
AK291652 mRNA Translation: BAF84341.1
CCDSiCCDS9706.1 [Q14112-1]
PIRiG00043
RefSeqiNP_031387.3, NM_007361.3 [Q14112-1]
UniGeneiHs.369840

3D structure databases

ProteinModelPortaliQ14112
SMRiQ14112
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116476, 38 interactors
IntActiQ14112, 4 interactors
MINTiQ14112
STRINGi9606.ENSP00000216286

PTM databases

GlyConnecti1569
iPTMnetiQ14112
PhosphoSitePlusiQ14112

Polymorphism and mutation databases

BioMutaiNID2
DMDMi290457669

Proteomic databases

EPDiQ14112
MaxQBiQ14112
PaxDbiQ14112
PeptideAtlasiQ14112
PRIDEiQ14112
ProteomicsDBi59817
59818 [Q14112-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216286; ENSP00000216286; ENSG00000087303 [Q14112-1]
GeneIDi22795
KEGGihsa:22795
UCSCiuc001wzo.4 human [Q14112-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22795
DisGeNETi22795
EuPathDBiHostDB:ENSG00000087303.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NID2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0026668
HGNCiHGNC:13389 NID2
HPAiHPA052460
HPA058772
MIMi605399 gene
neXtProtiNX_Q14112
OpenTargetsiENSG00000087303
PharmGKBiPA31626

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMYX Eukaryota
ENOG4111DVZ LUCA
GeneTreeiENSGT00940000157901
HOGENOMiHOG000072712
HOVERGENiHBG006498
InParanoidiQ14112
KOiK06826
OMAiRHAFCTD
OrthoDBiEOG091G030P
PhylomeDBiQ14112
TreeFamiTF320666

Enzyme and pathway databases

ReactomeiR-HSA-3000157 Laminin interactions

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NID2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NID2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22795

Protein Ontology

More...
PROi
PR:Q14112

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000087303 Expressed in 189 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_NID2
ExpressionAtlasiQ14112 baseline and differential
GenevisibleiQ14112 HS

Family and domain databases

CDDicd00255 nidG2, 1 hit
cd00191 TY, 2 hits
Gene3Di2.120.10.30, 1 hit
4.10.800.10, 2 hits
InterProiView protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR006605 G2_nidogen/fibulin_G2F
IPR009017 GFP
IPR009030 Growth_fac_rcpt_cys_sf
IPR000033 LDLR_classB_rpt
IPR003886 NIDO_dom
IPR000716 Thyroglobulin_1
IPR036857 Thyroglobulin_1_sf
PfamiView protein in Pfam
PF12662 cEGF, 1 hit
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 1 hit
PF07474 G2F, 1 hit
PF00058 Ldl_recept_b, 2 hits
PF06119 NIDO, 1 hit
PF00086 Thyroglobulin_1, 2 hits
SMARTiView protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 4 hits
SM00682 G2F, 1 hit
SM00135 LY, 5 hits
SM00539 NIDO, 1 hit
SM00211 TY, 2 hits
SUPFAMiSSF54511 SSF54511, 1 hit
SSF57184 SSF57184, 1 hit
SSF57610 SSF57610, 2 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS01186 EGF_2, 4 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 2 hits
PS51120 LDLRB, 4 hits
PS51220 NIDO, 1 hit
PS50993 NIDOGEN_G2, 1 hit
PS00484 THYROGLOBULIN_1_1, 2 hits
PS51162 THYROGLOBULIN_1_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNID2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14112
Secondary accession number(s): A8K6I7, B4DU19, O43710
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 2, 2010
Last modified: December 5, 2018
This is version 185 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again