Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-I

Gene

CCNI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • cyclin-dependent protein serine/threonine kinase regulator activity Source: GO_Central
  • protein kinase binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionCyclin

Enzyme and pathway databases

SignaLinkiQ14094

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-I
Gene namesi
Name:CCNI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000118816.9
HGNCiHGNC:1595 CCNI
neXtProtiNX_Q14094

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi10983
OpenTargetsiENSG00000118816
PharmGKBiPA26160

Polymorphism and mutation databases

BioMutaiCCNI
DMDMi9296954

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000804761 – 377Cyclin-IAdd BLAST377

Proteomic databases

EPDiQ14094
MaxQBiQ14094
PaxDbiQ14094
PeptideAtlasiQ14094
PRIDEiQ14094
ProteomicsDBi59809

PTM databases

iPTMnetiQ14094
PhosphoSitePlusiQ14094

Expressioni

Tissue specificityi

Highest levels in adult heart, brain and skeletal muscle. Lower levels in adult placenta, lung, kidney and pancreas. Also high levels in fetal brain and lower levels in fetal lung, liver and kidney. Also abundant in testis and thyroid.1 Publication

Developmental stagei

Expression is independent of the cell cycle in lung fibroblasts.1 Publication

Gene expression databases

BgeeiENSG00000118816 Expressed in 246 organ(s), highest expression level in cerebellum
CleanExiHS_CCNI
ExpressionAtlasiQ14094 baseline and differential
GenevisibleiQ14094 HS

Organism-specific databases

HPAiCAB010206
HPA039853
HPA061470

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ZMYND19Q96E354EBI-1104653,EBI-746595

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116179, 8 interactors
IntActiQ14094, 10 interactors
MINTiQ14094
STRINGi9606.ENSP00000237654

Structurei

3D structure databases

ProteinModelPortaliQ14094
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cyclin family.Curated

Phylogenomic databases

eggNOGiKOG0653 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00530000062971
HOVERGENiHBG050841
InParanoidiQ14094
OMAiRPKYLNC
OrthoDBiEOG091G0HQN
PhylomeDBiQ14094
TreeFamiTF101007

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR028856 Cyclin_I
IPR006671 Cyclin_N
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF187 PTHR10177:SF187, 1 hit
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
PIRSFiPIRSF001771 Cyclin_A_B_D_E, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14094-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKFPGPLENQ RLSFLLEKAI TREAQMWKVN VRKMPSNQNV SPSQRDEVIQ
60 70 80 90 100
WLAKLKYQFN LYPETFALAS SLLDRFLATV KAHPKYLSCI AISCFFLAAK
110 120 130 140 150
TVEEDERIPV LKVLARDSFC GCSSSEILRM ERIILDKLNW DLHTATPLDF
160 170 180 190 200
LHIFHAIAVS TRPQLLFSLP KLSPSQHLAV LTKQLLHCMA CNQLLQFRGS
210 220 230 240 250
MLALAMVSLE MEKLIPDWLS LTIELLQKAQ MDSSQLIHCR ELVAHHLSTL
260 270 280 290 300
QSSLPLNSVY VYRPLKHTLV TCDKGVFRLH PSSVPGPDFS KDNSKPEVPV
310 320 330 340 350
RGTAAFYHHL PAASGCKQTS TKRKVEEMEV DDFYDGIKRL YNEDNVSENV
360 370
GSVCGTDLSR QEGHASPCPP LQPVSVM
Length:377
Mass (Da):42,557
Last modified:November 1, 1996 - v1
Checksum:i2DE84EFA74698F6C
GO
Isoform 2 (identifier: Q14094-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQ → MTPRHHCEAYSSAGEEEEEEEEEK

Note: No experimental confirmation available.
Show »
Length:363
Mass (Da):40,877
Checksum:i60E38FDDF5FD108C
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RG12D6RG12_HUMAN
Cyclin-I
CCNI
125Annotation score:
D6RH01D6RH01_HUMAN
Cyclin-I
CCNI
80Annotation score:
D6RDK3D6RDK3_HUMAN
Cyclin-I
CCNI
56Annotation score:
H0YA27H0YA27_HUMAN
Cyclin-I
CCNI
177Annotation score:
D6REZ3D6REZ3_HUMAN
Cyclin-I
CCNI
49Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti9N → D no nucleotide entry (PubMed:9705831).Curated1
Sequence conflicti58Q → R no nucleotide entry (PubMed:9705831).Curated1
Sequence conflicti75R → G no nucleotide entry (PubMed:9705831).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_016312207V → I1 PublicationCorresponds to variant dbSNP:rs4252903Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566821 – 38MKFPG…MPSNQ → MTPRHHCEAYSSAGEEEEEE EEEK in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50310 mRNA Translation: BAA08849.1
AF135162 mRNA Translation: AAF43786.1
BT020019 mRNA Translation: AAV38822.1
AY207372 Genomic DNA Translation: AAO13492.1
AK301111 mRNA Translation: BAH13410.1
AK312632 mRNA Translation: BAG35517.1
AC104771 Genomic DNA No translation available.
AC111196 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05808.1
BC000420 mRNA Translation: AAH00420.1
BC004975 mRNA Translation: AAH04975.1
CCDSiCCDS3580.1 [Q14094-1]
PIRiJE0264
RefSeqiNP_001335061.1, NM_001348132.1 [Q14094-1]
NP_001335062.1, NM_001348133.1 [Q14094-1]
NP_001335063.1, NM_001348134.1 [Q14094-2]
NP_006826.1, NM_006835.2 [Q14094-1]
UniGeneiHs.518827

Genome annotation databases

EnsembliENST00000237654; ENSP00000237654; ENSG00000118816 [Q14094-1]
GeneIDi10983
KEGGihsa:10983
UCSCiuc003hkm.5 human [Q14094-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50310 mRNA Translation: BAA08849.1
AF135162 mRNA Translation: AAF43786.1
BT020019 mRNA Translation: AAV38822.1
AY207372 Genomic DNA Translation: AAO13492.1
AK301111 mRNA Translation: BAH13410.1
AK312632 mRNA Translation: BAG35517.1
AC104771 Genomic DNA No translation available.
AC111196 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05808.1
BC000420 mRNA Translation: AAH00420.1
BC004975 mRNA Translation: AAH04975.1
CCDSiCCDS3580.1 [Q14094-1]
PIRiJE0264
RefSeqiNP_001335061.1, NM_001348132.1 [Q14094-1]
NP_001335062.1, NM_001348133.1 [Q14094-1]
NP_001335063.1, NM_001348134.1 [Q14094-2]
NP_006826.1, NM_006835.2 [Q14094-1]
UniGeneiHs.518827

3D structure databases

ProteinModelPortaliQ14094
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116179, 8 interactors
IntActiQ14094, 10 interactors
MINTiQ14094
STRINGi9606.ENSP00000237654

PTM databases

iPTMnetiQ14094
PhosphoSitePlusiQ14094

Polymorphism and mutation databases

BioMutaiCCNI
DMDMi9296954

Proteomic databases

EPDiQ14094
MaxQBiQ14094
PaxDbiQ14094
PeptideAtlasiQ14094
PRIDEiQ14094
ProteomicsDBi59809

Protocols and materials databases

DNASUi10983
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000237654; ENSP00000237654; ENSG00000118816 [Q14094-1]
GeneIDi10983
KEGGihsa:10983
UCSCiuc003hkm.5 human [Q14094-1]

Organism-specific databases

CTDi10983
DisGeNETi10983
EuPathDBiHostDB:ENSG00000118816.9
GeneCardsiCCNI
HGNCiHGNC:1595 CCNI
HPAiCAB010206
HPA039853
HPA061470
neXtProtiNX_Q14094
OpenTargetsiENSG00000118816
PharmGKBiPA26160
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0653 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00530000062971
HOVERGENiHBG050841
InParanoidiQ14094
OMAiRPKYLNC
OrthoDBiEOG091G0HQN
PhylomeDBiQ14094
TreeFamiTF101007

Enzyme and pathway databases

SignaLinkiQ14094

Miscellaneous databases

ChiTaRSiCCNI human
GeneWikiiCCNI_(gene)
GenomeRNAii10983
PROiPR:Q14094

Gene expression databases

BgeeiENSG00000118816 Expressed in 246 organ(s), highest expression level in cerebellum
CleanExiHS_CCNI
ExpressionAtlasiQ14094 baseline and differential
GenevisibleiQ14094 HS

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR028856 Cyclin_I
IPR006671 Cyclin_N
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF187 PTHR10177:SF187, 1 hit
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
PIRSFiPIRSF001771 Cyclin_A_B_D_E, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCCNI_HUMAN
AccessioniPrimary (citable) accession number: Q14094
Secondary accession number(s): B2R6M0, B7Z6X4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again