Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-I

Gene

CCNI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cyclin-dependent protein serine/threonine kinase regulator activity Source: GO_Central
  • protein kinase binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCyclin

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q14094

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-I
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCNI
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000118816.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1595 CCNI

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14094

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10983

Open Targets

More...
OpenTargetsi
ENSG00000118816

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26160

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CCNI

Domain mapping of disease mutations (DMDM)

More...
DMDMi
9296954

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000804761 – 377Cyclin-IAdd BLAST377

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14094

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14094

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14094

PeptideAtlas

More...
PeptideAtlasi
Q14094

PRoteomics IDEntifications database

More...
PRIDEi
Q14094

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59809

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14094

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14094

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest levels in adult heart, brain and skeletal muscle. Lower levels in adult placenta, lung, kidney and pancreas. Also high levels in fetal brain and lower levels in fetal lung, liver and kidney. Also abundant in testis and thyroid.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression is independent of the cell cycle in lung fibroblasts.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000118816 Expressed in 246 organ(s), highest expression level in cerebellum

CleanEx database of gene expression profiles

More...
CleanExi
HS_CCNI

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14094 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14094 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB010206
HPA039853
HPA061470

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ZMYND19Q96E354EBI-1104653,EBI-746595

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116179, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q14094, 10 interactors

Molecular INTeraction database

More...
MINTi
Q14094

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000237654

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14094

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cyclin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0653 Eukaryota
COG5024 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154827

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050841

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14094

Identification of Orthologs from Complete Genome Data

More...
OMAi
RPKYLNC

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0HQN

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14094

TreeFam database of animal gene trees

More...
TreeFami
TF101007

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00043 CYCLIN, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR028856 Cyclin_I
IPR006671 Cyclin_N

The PANTHER Classification System

More...
PANTHERi
PTHR10177 PTHR10177, 1 hit
PTHR10177:SF187 PTHR10177:SF187, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00134 Cyclin_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001771 Cyclin_A_B_D_E, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00385 CYCLIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47954 SSF47954, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14094-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKFPGPLENQ RLSFLLEKAI TREAQMWKVN VRKMPSNQNV SPSQRDEVIQ
60 70 80 90 100
WLAKLKYQFN LYPETFALAS SLLDRFLATV KAHPKYLSCI AISCFFLAAK
110 120 130 140 150
TVEEDERIPV LKVLARDSFC GCSSSEILRM ERIILDKLNW DLHTATPLDF
160 170 180 190 200
LHIFHAIAVS TRPQLLFSLP KLSPSQHLAV LTKQLLHCMA CNQLLQFRGS
210 220 230 240 250
MLALAMVSLE MEKLIPDWLS LTIELLQKAQ MDSSQLIHCR ELVAHHLSTL
260 270 280 290 300
QSSLPLNSVY VYRPLKHTLV TCDKGVFRLH PSSVPGPDFS KDNSKPEVPV
310 320 330 340 350
RGTAAFYHHL PAASGCKQTS TKRKVEEMEV DDFYDGIKRL YNEDNVSENV
360 370
GSVCGTDLSR QEGHASPCPP LQPVSVM
Length:377
Mass (Da):42,557
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2DE84EFA74698F6C
GO
Isoform 2 (identifier: Q14094-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQ → MTPRHHCEAYSSAGEEEEEEEEEK

Note: No experimental confirmation available.
Show »
Length:363
Mass (Da):40,877
Checksum:i60E38FDDF5FD108C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RG12D6RG12_HUMAN
Cyclin-I
CCNI
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RH01D6RH01_HUMAN
Cyclin-I
CCNI
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDK3D6RDK3_HUMAN
Cyclin-I
CCNI
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA27H0YA27_HUMAN
Cyclin-I
CCNI
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6REZ3D6REZ3_HUMAN
Cyclin-I
CCNI
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti9N → D no nucleotide entry (PubMed:9705831).Curated1
Sequence conflicti58Q → R no nucleotide entry (PubMed:9705831).Curated1
Sequence conflicti75R → G no nucleotide entry (PubMed:9705831).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_016312207V → I1 PublicationCorresponds to variant dbSNP:rs4252903Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566821 – 38MKFPG…MPSNQ → MTPRHHCEAYSSAGEEEEEE EEEK in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D50310 mRNA Translation: BAA08849.1
AF135162 mRNA Translation: AAF43786.1
BT020019 mRNA Translation: AAV38822.1
AY207372 Genomic DNA Translation: AAO13492.1
AK301111 mRNA Translation: BAH13410.1
AK312632 mRNA Translation: BAG35517.1
AC104771 Genomic DNA No translation available.
AC111196 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05808.1
BC000420 mRNA Translation: AAH00420.1
BC004975 mRNA Translation: AAH04975.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3580.1 [Q14094-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JE0264

NCBI Reference Sequences

More...
RefSeqi
NP_001335061.1, NM_001348132.1 [Q14094-1]
NP_001335062.1, NM_001348133.1 [Q14094-1]
NP_001335063.1, NM_001348134.1 [Q14094-2]
NP_006826.1, NM_006835.2 [Q14094-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.518827

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000237654; ENSP00000237654; ENSG00000118816 [Q14094-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10983

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10983

UCSC genome browser

More...
UCSCi
uc003hkm.5 human [Q14094-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50310 mRNA Translation: BAA08849.1
AF135162 mRNA Translation: AAF43786.1
BT020019 mRNA Translation: AAV38822.1
AY207372 Genomic DNA Translation: AAO13492.1
AK301111 mRNA Translation: BAH13410.1
AK312632 mRNA Translation: BAG35517.1
AC104771 Genomic DNA No translation available.
AC111196 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05808.1
BC000420 mRNA Translation: AAH00420.1
BC004975 mRNA Translation: AAH04975.1
CCDSiCCDS3580.1 [Q14094-1]
PIRiJE0264
RefSeqiNP_001335061.1, NM_001348132.1 [Q14094-1]
NP_001335062.1, NM_001348133.1 [Q14094-1]
NP_001335063.1, NM_001348134.1 [Q14094-2]
NP_006826.1, NM_006835.2 [Q14094-1]
UniGeneiHs.518827

3D structure databases

ProteinModelPortaliQ14094
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116179, 8 interactors
IntActiQ14094, 10 interactors
MINTiQ14094
STRINGi9606.ENSP00000237654

PTM databases

iPTMnetiQ14094
PhosphoSitePlusiQ14094

Polymorphism and mutation databases

BioMutaiCCNI
DMDMi9296954

Proteomic databases

EPDiQ14094
MaxQBiQ14094
PaxDbiQ14094
PeptideAtlasiQ14094
PRIDEiQ14094
ProteomicsDBi59809

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10983
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000237654; ENSP00000237654; ENSG00000118816 [Q14094-1]
GeneIDi10983
KEGGihsa:10983
UCSCiuc003hkm.5 human [Q14094-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10983
DisGeNETi10983
EuPathDBiHostDB:ENSG00000118816.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CCNI
HGNCiHGNC:1595 CCNI
HPAiCAB010206
HPA039853
HPA061470
neXtProtiNX_Q14094
OpenTargetsiENSG00000118816
PharmGKBiPA26160

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0653 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00940000154827
HOVERGENiHBG050841
InParanoidiQ14094
OMAiRPKYLNC
OrthoDBiEOG091G0HQN
PhylomeDBiQ14094
TreeFamiTF101007

Enzyme and pathway databases

SignaLinkiQ14094

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CCNI human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CCNI_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10983

Protein Ontology

More...
PROi
PR:Q14094

Gene expression databases

BgeeiENSG00000118816 Expressed in 246 organ(s), highest expression level in cerebellum
CleanExiHS_CCNI
ExpressionAtlasiQ14094 baseline and differential
GenevisibleiQ14094 HS

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR028856 Cyclin_I
IPR006671 Cyclin_N
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF187 PTHR10177:SF187, 1 hit
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
PIRSFiPIRSF001771 Cyclin_A_B_D_E, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCNI_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14094
Secondary accession number(s): B2R6M0, B7Z6X4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again