Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Isopentenyl-diphosphate Delta-isomerase 1

Gene

IDI1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 PublicationNote: Binds 1 Mg2+ ion per subunit.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: dimethylallyl diphosphate biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes dimethylallyl diphosphate from isopentenyl diphosphate.
Proteins known to be involved in this subpathway in this organism are:
  1. Isopentenyl-diphosphate Delta-isomerase 1 (IDI1), Isopentenyl-diphosphate delta-isomerase 2 (IDI2)
This subpathway is part of the pathway dimethylallyl diphosphate biosynthesis, which is itself part of Isoprenoid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes dimethylallyl diphosphate from isopentenyl diphosphate, the pathway dimethylallyl diphosphate biosynthesis and in Isoprenoid biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei36Substrate1 Publication1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi40Magnesium1
Metal bindingi51Magnesium1
Binding sitei70Substrate1 Publication1
Binding sitei74Substrate1 Publication1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei861
Binding sitei87Substrate1 Publication1
Metal bindingi146Magnesium1
Active sitei1481
Metal bindingi148Magnesium1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase
Biological processCholesterol biosynthesis, Cholesterol metabolism, Isoprene biosynthesis, Lipid biosynthesis, Lipid metabolism, Steroid biosynthesis, Steroid metabolism, Sterol biosynthesis, Sterol metabolism
LigandMagnesium, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS00895-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
5.3.3.2 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-191273 Cholesterol biosynthesis
R-HSA-2426168 Activation of gene expression by SREBF (SREBP)

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q13907

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00059;UER00104

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001219 [Q13907-1]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Isopentenyl-diphosphate Delta-isomerase 1 (EC:5.3.3.2)
Alternative name(s):
Isopentenyl pyrophosphate isomerase 1
Short name:
IPP isomerase 1
Short name:
IPPI1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IDI1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000067064.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5387 IDI1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604055 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13907

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Peroxisome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000067064

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29635

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB01785 Dimethylallyl Diphosphate

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
646

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IDI1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
6225527

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002052221 – 227Isopentenyl-diphosphate Delta-isomerase 1Add BLAST227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei176N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13907

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13907

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13907

PeptideAtlas

More...
PeptideAtlasi
Q13907

PRoteomics IDEntifications database

More...
PRIDEi
Q13907

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59723
59724 [Q13907-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13907

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13907

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000067064 Expressed in 231 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_IDI1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13907 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13907 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039169

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109648, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q13907, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000370748

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q13907

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13907

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q13907

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini49 – 199Nudix hydrolasePROSITE-ProRule annotationAdd BLAST151

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi225 – 227Microbody targeting signal3

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the IPP isomerase type 1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0142 Eukaryota
COG1443 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008527

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG002995

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13907

KEGG Orthology (KO)

More...
KOi
K01823

Identification of Orthologs from Complete Genome Data

More...
OMAi
LRLCPWF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0LWP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13907

TreeFam database of animal gene trees

More...
TreeFami
TF300129

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02885 IPP_Isomerase, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011876 IsopentenylPP_isomerase_typ1
IPR015797 NUDIX_hydrolase-like_dom_sf
IPR000086 NUDIX_hydrolase_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10885 PTHR10885, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00293 NUDIX, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF018427 Isopntndiph_ism, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55811 SSF55811, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02150 IPP_isom_1, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51462 NUDIX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13907-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPEINTNHLD KQQVQLLAEM CILIDENDNK IGAETKKNCH LNENIEKGLL
60 70 80 90 100
HRAFSVFLFN TENKLLLQQR SDAKITFPGC FTNTCCSHPL SNPAELEESD
110 120 130 140 150
ALGVRRAAQR RLKAELGIPL EEVPPEEINY LTRIHYKAQS DGIWGEHEID
160 170 180 190 200
YILLVRKNVT LNPDPNEIKS YCYVSKEELK ELLKKAASGE IKITPWFKII
210 220
AATFLFKWWD NLNHLNQFVD HEKIYRM
Length:227
Mass (Da):26,319
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1255ACC2C4D1E8D1
GO
Isoform 2 (identifier: Q13907-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWRGLALARAIGCAARGRGQWAVRAADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMM

Show »
Length:284
Mass (Da):32,485
Checksum:i80478664FEBD5978
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JKM8C9JKM8_HUMAN
Isopentenyl-diphosphate Delta-isome...
IDI1
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JD53C9JD53_HUMAN
Isopentenyl-diphosphate Delta-isome...
IDI1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH57827 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAK29357 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAK49434 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAK49435 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAP35407 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAA34890 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45I → V in BAD96595 (Ref. 9) Curated1
Sequence conflicti101A → T in AAH19227 (PubMed:15489334).Curated1
Sequence conflicti156R → G in BAD96595 (Ref. 9) Curated1
Sequence conflicti173Y → H in AAH06999 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q13907-2)
Sequence conflicti39V → G in AAI07894 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0378891M → MWRGLALARAIGCAARGRGQ WAVRAADCAQSGRHPGPAVV CGRRLISVLEQIRHFVMM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X17025 mRNA Translation: CAA34890.1 Different initiation.
AF291755 Genomic DNA Translation: AAK29357.1 Different initiation.
AF271720 mRNA Translation: AAK49435.1 Different initiation.
AF271724
, AF271721, AF271722, AF271723 Genomic DNA Translation: AAK49434.1 Different initiation.
BT006761 mRNA Translation: AAP35407.1 Different initiation.
AK303669 mRNA Translation: BAG64667.1
AC022536 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86521.1
BC005247 mRNA Translation: AAH05247.2
BC006999 mRNA Translation: AAH06999.2
BC019227 mRNA Translation: AAH19227.2
BC022418 mRNA Translation: AAH22418.2
BC025375 mRNA Translation: AAH25375.2
BC057827 mRNA Translation: AAH57827.1 Different initiation.
BC107893 mRNA Translation: AAI07894.1
AK222875 mRNA Translation: BAD96595.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7056.1 [Q13907-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001304884.1, NM_001317955.1
NP_001304885.1, NM_001317956.1
NP_001304886.1, NM_001317957.1
NP_004499.2, NM_004508.3 [Q13907-2]
XP_011517759.1, XM_011519457.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.283652
Hs.604449
Hs.661502

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000381344; ENSP00000370748; ENSG00000067064 [Q13907-2]
ENST00000429642; ENSP00000401879; ENSG00000067064 [Q13907-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3422

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3422

UCSC genome browser

More...
UCSCi
uc001iga.4 human [Q13907-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17025 mRNA Translation: CAA34890.1 Different initiation.
AF291755 Genomic DNA Translation: AAK29357.1 Different initiation.
AF271720 mRNA Translation: AAK49435.1 Different initiation.
AF271724
, AF271721, AF271722, AF271723 Genomic DNA Translation: AAK49434.1 Different initiation.
BT006761 mRNA Translation: AAP35407.1 Different initiation.
AK303669 mRNA Translation: BAG64667.1
AC022536 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86521.1
BC005247 mRNA Translation: AAH05247.2
BC006999 mRNA Translation: AAH06999.2
BC019227 mRNA Translation: AAH19227.2
BC022418 mRNA Translation: AAH22418.2
BC025375 mRNA Translation: AAH25375.2
BC057827 mRNA Translation: AAH57827.1 Different initiation.
BC107893 mRNA Translation: AAI07894.1
AK222875 mRNA Translation: BAD96595.1
CCDSiCCDS7056.1 [Q13907-2]
RefSeqiNP_001304884.1, NM_001317955.1
NP_001304885.1, NM_001317956.1
NP_001304886.1, NM_001317957.1
NP_004499.2, NM_004508.3 [Q13907-2]
XP_011517759.1, XM_011519457.1
UniGeneiHs.283652
Hs.604449
Hs.661502

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DHOX-ray1.60A1-227[»]
2I6KX-ray2.00A/B1-227[»]
2ICJX-ray1.70A1-227[»]
2ICKX-ray1.93A1-227[»]
ProteinModelPortaliQ13907
SMRiQ13907
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109648, 4 interactors
IntActiQ13907, 5 interactors
STRINGi9606.ENSP00000370748

Chemistry databases

DrugBankiDB01785 Dimethylallyl Diphosphate
GuidetoPHARMACOLOGYi646
SwissLipidsiSLP:000001219 [Q13907-1]

PTM databases

iPTMnetiQ13907
PhosphoSitePlusiQ13907

Polymorphism and mutation databases

BioMutaiIDI1
DMDMi6225527

Proteomic databases

EPDiQ13907
MaxQBiQ13907
PaxDbiQ13907
PeptideAtlasiQ13907
PRIDEiQ13907
ProteomicsDBi59723
59724 [Q13907-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3422
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381344; ENSP00000370748; ENSG00000067064 [Q13907-2]
ENST00000429642; ENSP00000401879; ENSG00000067064 [Q13907-1]
GeneIDi3422
KEGGihsa:3422
UCSCiuc001iga.4 human [Q13907-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3422
EuPathDBiHostDB:ENSG00000067064.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IDI1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0008588
HGNCiHGNC:5387 IDI1
HPAiHPA039169
MIMi604055 gene
neXtProtiNX_Q13907
OpenTargetsiENSG00000067064
PharmGKBiPA29635

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0142 Eukaryota
COG1443 LUCA
GeneTreeiENSGT00390000008527
HOVERGENiHBG002995
InParanoidiQ13907
KOiK01823
OMAiLRLCPWF
OrthoDBiEOG091G0LWP
PhylomeDBiQ13907
TreeFamiTF300129

Enzyme and pathway databases

UniPathwayi
UPA00059;UER00104

BioCyciMetaCyc:HS00895-MONOMER
BRENDAi5.3.3.2 2681
ReactomeiR-HSA-191273 Cholesterol biosynthesis
R-HSA-2426168 Activation of gene expression by SREBF (SREBP)
SABIO-RKiQ13907

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IDI1 human
EvolutionaryTraceiQ13907

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3422

Protein Ontology

More...
PROi
PR:Q13907

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000067064 Expressed in 231 organ(s), highest expression level in testis
CleanExiHS_IDI1
ExpressionAtlasiQ13907 baseline and differential
GenevisibleiQ13907 HS

Family and domain databases

CDDicd02885 IPP_Isomerase, 1 hit
InterProiView protein in InterPro
IPR011876 IsopentenylPP_isomerase_typ1
IPR015797 NUDIX_hydrolase-like_dom_sf
IPR000086 NUDIX_hydrolase_dom
PANTHERiPTHR10885 PTHR10885, 1 hit
PfamiView protein in Pfam
PF00293 NUDIX, 1 hit
PIRSFiPIRSF018427 Isopntndiph_ism, 1 hit
SUPFAMiSSF55811 SSF55811, 1 hit
TIGRFAMsiTIGR02150 IPP_isom_1, 1 hit
PROSITEiView protein in PROSITE
PS51462 NUDIX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIDI1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13907
Secondary accession number(s): B4E155
, Q32Q13, Q53GQ6, Q86U81, Q8WUX8, Q96IZ4, Q9BQ74
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: December 5, 2018
This is version 178 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again