Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ectonucleotide pyrophosphatase/phosphodiesterase family member 2

Gene

ENPP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:15769751, PubMed:26371182, PubMed:27754931). Major substrate is lysophosphatidylcholine (PubMed:12176993, PubMed:27754931). Also can act on sphingosylphosphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP (PubMed:15769751, PubMed:12176993). Involved in several motility-related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation (PubMed:11559573). Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein (PubMed:1733949). May have a role in induction of parturition (PubMed:12176993). Possible involvement in cell proliferation and adipose tissue development (Probable). Tumor cell motility-stimulating factor (PubMed:1733949, PubMed:11559573).1 Publication7 Publications

Catalytic activityi

1-alkyl-sn-glycero-3-phosphoethanolamine + H2O = 1-alkyl-sn-glycerol 3-phosphate + ethanolamine.6 Publications

Cofactori

Protein has several cofactor binding sites:

Activity regulationi

Inhibited by lysophosphatidic acid (LPA) and sphingosine-1-phosphate (S1P). Inhibited by EDTA and EGTA (Probable).3 Publications

Kineticsi

  1. KM=0.5 mM for 16:0-LPC (at pH 8.5)2 Publications
  2. KM=5.5 mM for pNP-TMP (at pH 8.5)2 Publications
  3. KM=11.3 mM for pNppp (isoform 1)2 Publications
  4. KM=5.7 mM for pNppp (isoform 2)2 Publications
  5. KM=19.8 mM for pNppp (isoform 3)2 Publications
  1. Vmax=1.9 nmol/min/µg enzyme with pNppp as substrate (isoform 1)2 Publications
  2. Vmax=0.67 nmol/min/µg enzyme with pNppp as substrate (isoform 2)2 Publications
  3. Vmax=1.6 nmol/min/µg enzyme with pNppp as substrate (isoform 3)2 Publications

pH dependencei

Optimum pH is 9.0 (isoform 1), 8.0 (isoform 3). Isoform 1 is less sensitive to pH. Isoform 1, isoform 2 and isoform 3 all retain some activity at pH 9.5.2 Publications

Temperature dependencei

Isoform 1 and isoform 3 are active from 45 to 60 degrees Celsius.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi172Zinc 1; catalyticCombined sources2 Publications1
Active sitei210NucleophileBy similarity1
Metal bindingi210Zinc 1; catalyticCombined sources2 Publications1
Binding sitei231SubstrateCombined sources1 Publication1
Binding sitei307SubstrateBy similarity1
Metal bindingi312Zinc 2; catalyticCombined sources1 Publication1
Metal bindingi316Zinc 2; via tele nitrogen; catalyticCombined sources1 Publication1
Metal bindingi359Zinc 1; catalyticCombined sources2 Publications1
Metal bindingi360Zinc 1; via tele nitrogen; catalyticCombined sources2 Publications1
Metal bindingi475Zinc 2; via tele nitrogen; catalyticCombined sources1 Publication1
Metal bindingi740CalciumCombined sources2 Publications1
Metal bindingi742CalciumCombined sources2 Publications1
Metal bindingi744CalciumCombined sources1 Publication1
Metal bindingi746Calcium; via carbonyl oxygenCombined sources2 Publications1
Metal bindingi748CalciumCombined sources2 Publications1
Sitei853Essential for catalytic activityBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
Biological processChemotaxis, Lipid degradation, Lipid metabolism
LigandCalcium, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciMetaCyc:HS06258-MONOMER
BRENDAi3.1.4.39 2681
ReactomeiR-HSA-199220 Vitamin B5 (pantothenate) metabolism
SABIO-RKiQ13822

Chemistry databases

SwissLipidsiSLP:000000393
SLP:000000641 [Q13822-1]

Names & Taxonomyi

Protein namesi
Recommended name:
Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 (EC:3.1.4.395 Publications)
Short name:
E-NPP 2
Alternative name(s):
Autotaxin2 Publications
Extracellular lysophospholipase D
Short name:
LysoPLD1 Publication
Gene namesi
Name:ENPP2
Synonyms:ATX2 Publications, PDNP21 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000136960.12
HGNCiHGNC:3357 ENPP2
MIMi601060 gene
neXtProtiNX_Q13822

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi170S → E: Reduces lysophospholipase activity by about 70%. 1
Mutagenesisi210T → A: Loss of lysophospholipase activity. 1 Publication1
Mutagenesisi211F → Y: Reduces lysophospholipase activity by about 70%. 1 Publication1
Mutagenesisi218A → V: Reduces lysophospholipase activity by about 50%. 1 Publication1
Mutagenesisi231N → A: Strongly reduced lysophospholipase activity. 1 Publication1
Mutagenesisi307Y → Q: Reduces lysophospholipase activity by about 70%. 1 Publication1

Keywords - Diseasei

Obesity

Organism-specific databases

DisGeNETi5168
OpenTargetsiENSG00000136960
PharmGKBiPA27792

Chemistry databases

ChEMBLiCHEMBL3691
GuidetoPHARMACOLOGYi2901

Polymorphism and mutation databases

BioMutaiENPP2
DMDMi290457674

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 27By similarityAdd BLAST27
PropeptideiPRO_000028164928 – 35Removed by furin2 Publications8
ChainiPRO_000018856736 – 863Ectonucleotide pyrophosphatase/phosphodiesterase family member 2Add BLAST828

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi54N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi59 ↔ 76PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi63 ↔ 94PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi74 ↔ 87PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi80 ↔ 86PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi103 ↔ 120PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi108 ↔ 138PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi118 ↔ 131PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi124 ↔ 130PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi149 ↔ 195PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi157 ↔ 351PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi367 ↔ 469PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi411N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi414 ↔ 806PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi525N-linked (GlcNAc...) asparagineCombined sources1 Publication1
Disulfide bondi567 ↔ 667PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi569 ↔ 652PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi775 ↔ 785PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi807N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-glycosylation, but not furin-cleavage, plays a critical role on secretion and on lysoPLD activity.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlasiQ13822
PRIDEiQ13822
ProteomicsDBi59692
59693 [Q13822-2]
59694 [Q13822-3]

PTM databases

GlyConnecti1197
iPTMnetiQ13822
PhosphoSitePlusiQ13822

Expressioni

Tissue specificityi

Detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). Predominantly expressed in brain, placenta, ovary, and small intestine. Expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. Expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. Not detected in leukocytes. Isoform 1 is more highly expressed in peripheral tissues than in the central nervous system (CNS). Adipocytes only express isoform 1. Isoform 3 is more highly expressed in the brain than in peripheral tissues.5 Publications

Inductioni

Up-regulated in massively obese subjects with glucose intolerance, and during adipogenesis.1 Publication

Gene expression databases

BgeeiENSG00000136960 Expressed in 235 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_ENPP2
ExpressionAtlasiQ13822 baseline and differential
GenevisibleiQ13822 HS

Organism-specific databases

HPAiHPA023700
HPA053652

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111194, 3 interactors
IntActiQ13822, 2 interactors
MINTiQ13822

Chemistry databases

BindingDBiQ13822

Structurei

Secondary structure

1863
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ13822
SMRiQ13822
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini55 – 98SMB 1PROSITE-ProRule annotationAdd BLAST44
Domaini99 – 143SMB 2PROSITE-ProRule annotationAdd BLAST45

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni211 – 214Substrate bindingBy similarity4
Regioni244 – 255Substrate bindingBy similarityAdd BLAST12
Regioni830 – 851Required for secretionBy similarityAdd BLAST22

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi127 – 129Cell attachment siteSequence analysis3

Sequence similaritiesi

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

GeneTreeiENSGT00760000119157
HOVERGENiHBG051484
InParanoidiQ13822
KOiK01122
OMAiDGLHDTQ
OrthoDBiEOG091G017X
PhylomeDBiQ13822
TreeFamiTF330032

Family and domain databases

Gene3Di3.40.720.10, 1 hit
InterProiView protein in InterPro
IPR017849 Alkaline_Pase-like_a/b/a
IPR017850 Alkaline_phosphatase_core_sf
IPR001604 DNA/RNA_non-sp_Endonuclease
IPR029881 ENPP2
IPR020821 Extracellular_endonuc_su_A
IPR002591 Phosphodiest/P_Trfase
IPR036024 Somatomedin_B-like_dom_sf
IPR020436 Somatomedin_B_chordata
IPR001212 Somatomedin_B_dom
PANTHERiPTHR10151:SF21 PTHR10151:SF21, 1 hit
PfamiView protein in Pfam
PF01223 Endonuclease_NS, 1 hit
PF01663 Phosphodiest, 1 hit
PF01033 Somatomedin_B, 2 hits
PRINTSiPR00022 SOMATOMEDINB
SMARTiView protein in SMART
SM00892 Endonuclease_NS, 1 hit
SM00477 NUC, 1 hit
SM00201 SO, 2 hits
SUPFAMiSSF53649 SSF53649, 1 hit
SSF90188 SSF90188, 2 hits
PROSITEiView protein in PROSITE
PS00524 SMB_1, 2 hits
PS50958 SMB_2, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13822-1) [UniParc]FASTAAdd to basket
Also known as: ATXter, Beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARRSSFQSC QIISLFTFAV GVNICLGFTA HRIKRAEGWE EGPPTVLSDS
60 70 80 90 100
PWTNISGSCK GRCFELQEAG PPDCRCDNLC KSYTSCCHDF DELCLKTARG
110 120 130 140 150
WECTKDRCGE VRNEENACHC SEDCLARGDC CTNYQVVCKG ESHWVDDDCE
160 170 180 190 200
EIKAAECPAG FVRPPLIIFS VDGFRASYMK KGSKVMPNIE KLRSCGTHSP
210 220 230 240 250
YMRPVYPTKT FPNLYTLATG LYPESHGIVG NSMYDPVFDA TFHLRGREKF
260 270 280 290 300
NHRWWGGQPL WITATKQGVK AGTFFWSVVI PHERRILTIL QWLTLPDHER
310 320 330 340 350
PSVYAFYSEQ PDFSGHKYGP FGPEMTNPLR EIDKIVGQLM DGLKQLKLHR
360 370 380 390 400
CVNVIFVGDH GMEDVTCDRT EFLSNYLTNV DDITLVPGTL GRIRSKFSNN
410 420 430 440 450
AKYDPKAIIA NLTCKKPDQH FKPYLKQHLP KRLHYANNRR IEDIHLLVER
460 470 480 490 500
RWHVARKPLD VYKKPSGKCF FQGDHGFDNK VNSMQTVFVG YGSTFKYKTK
510 520 530 540 550
VPPFENIELY NVMCDLLGLK PAPNNGTHGS LNHLLRTNTF RPTMPEEVTR
560 570 580 590 600
PNYPGIMYLQ SDFDLGCTCD DKVEPKNKLD ELNKRLHTKG STEERHLLYG
610 620 630 640 650
RPAVLYRTRY DILYHTDFES GYSEIFLMPL WTSYTVSKQA EVSSVPDHLT
660 670 680 690 700
SCVRPDVRVS PSFSQNCLAY KNDKQMSYGF LFPPYLSSSP EAKYDAFLVT
710 720 730 740 750
NMVPMYPAFK RVWNYFQRVL VKKYASERNG VNVISGPIFD YDYDGLHDTE
760 770 780 790 800
DKIKQYVEGS SIPVPTHYYS IITSCLDFTQ PADKCDGPLS VSSFILPHRP
810 820 830 840 850
DNEESCNSSE DESKWVEELM KMHTARVRDI EHLTSLDFFR KTSRSYPEIL
860
TLKTYLHTYE SEI
Length:863
Mass (Da):98,994
Last modified:March 2, 2010 - v3
Checksum:i94A7A2B3701F0993
GO
Isoform 2 (identifier: Q13822-2) [UniParc]FASTAAdd to basket
Also known as: ATXmel, Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     324-324: E → EESSYGSPFTPAKRPKRKVAPKRRQERPVAPPKKRRRKIHRMDHYAAETRQDK

Show »
Length:915
Mass (Da):105,201
Checksum:i30C7CB1E60101B75
GO
Isoform 3 (identifier: Q13822-3) [UniParc]FASTAAdd to basket
Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: E → EAETRKFRGSRNENKENINGNFEPRK

Show »
Length:888
Mass (Da):101,968
Checksum:i17A8986783028C4D
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RIB9E5RIB9_HUMAN
Ectonucleotide pyrophosphatase/phos...
ENPP2
162Annotation score:
E5RJ49E5RJ49_HUMAN
Ectonucleotide pyrophosphatase/phos...
ENPP2
245Annotation score:
E7EUF1E7EUF1_HUMAN
Ectonucleotide pyrophosphatase/phos...
ENPP2
884Annotation score:
E5RIA2E5RIA2_HUMAN
Ectonucleotide pyrophosphatase/phos...
ENPP2
498Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23N → S in AAA64785 (PubMed:7982964).Curated1
Sequence conflicti23N → S in ABW38316 (PubMed:18175805).Curated1
Sequence conflicti73D → H in BAA08260 (PubMed:8586446).Curated1
Sequence conflicti100G → A in AAB00855 (PubMed:8579579).Curated1
Sequence conflicti291Q → R in AAA64785 (PubMed:7982964).Curated1
Sequence conflicti291Q → R in ABW38316 (PubMed:18175805).Curated1
Sequence conflicti349H → R in AAA64785 (PubMed:7982964).Curated1
Sequence conflicti349H → R in ABW38316 (PubMed:18175805).Curated1
Sequence conflicti457K → P AA sequence (PubMed:1733949).Curated1
Sequence conflicti501V → S AA sequence (PubMed:1733949).Curated1
Sequence conflicti508E → N AA sequence (PubMed:1733949).Curated1
Sequence conflicti554P → L AA sequence (PubMed:1733949).Curated1
Sequence conflicti629P → L in AAA64785 (PubMed:7982964).Curated1
Sequence conflicti629P → L in ABW38316 (PubMed:18175805).Curated1
Sequence conflicti644S → R in BAA08260 (PubMed:8586446).Curated1
Sequence conflicti703V → A in BAA08260 (PubMed:8586446).Curated1
Sequence conflicti769Y → H in BAA08260 (PubMed:8586446).Curated1
Isoform 3 (identifier: Q13822-3)
Sequence conflicti23N → S in ABW38316 (PubMed:18175805).1
Sequence conflicti291Q → R in ABW38316 (PubMed:18175805).1
Sequence conflicti349H → R in ABW38316 (PubMed:18175805).1
Sequence conflicti493S → P in ABW38316 (PubMed:18175805).1
Sequence conflicti599F → Y in ABW38316 (PubMed:18175805).1
Sequence conflicti602S → T in ABW38316 (PubMed:18175805).1
Sequence conflicti654P → L in ABW38316 (PubMed:18175805).1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060469493S → P7 PublicationsCorresponds to variant dbSNP:rs10283100Ensembl.1
Natural variantiVAR_057472577N → S. Corresponds to variant dbSNP:rs2289886Ensembl.1
Natural variantiVAR_057473726S → L. Corresponds to variant dbSNP:rs16892767Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006750324E → EESSYGSPFTPAKRPKRKVA PKRRQERPVAPPKKRRRKIH RMDHYAAETRQDK in isoform 2. 2 Publications1
Alternative sequenceiVSP_036398593E → EAETRKFRGSRNENKENING NFEPRK in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L35594 mRNA Translation: AAA64785.1
D45421 mRNA Translation: BAA08260.1
D45914 Genomic DNA Translation: BAA08342.1
L46720 mRNA Translation: AAB00855.1
EU131011 mRNA Translation: ABW38316.2
AC099818 Genomic DNA No translation available.
AC107960 Genomic DNA No translation available.
BC034961 mRNA Translation: AAH34961.1
CCDSiCCDS34936.1 [Q13822-1]
CCDS47914.1 [Q13822-3]
CCDS6329.1 [Q13822-2]
PIRiA55144
RefSeqiNP_001035181.1, NM_001040092.2 [Q13822-1]
NP_001124335.1, NM_001130863.2 [Q13822-3]
NP_006200.3, NM_006209.4 [Q13822-2]
UniGeneiHs.190977

Genome annotation databases

EnsembliENST00000075322; ENSP00000075322; ENSG00000136960 [Q13822-1]
ENST00000259486; ENSP00000259486; ENSG00000136960 [Q13822-2]
ENST00000522826; ENSP00000428291; ENSG00000136960 [Q13822-3]
GeneIDi5168
KEGGihsa:5168
UCSCiuc003yos.3 human [Q13822-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L35594 mRNA Translation: AAA64785.1
D45421 mRNA Translation: BAA08260.1
D45914 Genomic DNA Translation: BAA08342.1
L46720 mRNA Translation: AAB00855.1
EU131011 mRNA Translation: ABW38316.2
AC099818 Genomic DNA No translation available.
AC107960 Genomic DNA No translation available.
BC034961 mRNA Translation: AAH34961.1
CCDSiCCDS34936.1 [Q13822-1]
CCDS47914.1 [Q13822-3]
CCDS6329.1 [Q13822-2]
PIRiA55144
RefSeqiNP_001035181.1, NM_001040092.2 [Q13822-1]
NP_001124335.1, NM_001130863.2 [Q13822-3]
NP_006200.3, NM_006209.4 [Q13822-2]
UniGeneiHs.190977

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZG6X-ray1.80A/B17-863[»]
4ZG7X-ray1.75A55-860[»]
4ZG9X-ray2.95A/B1-863[»]
4ZGAX-ray2.60A1-863[»]
5KXAX-ray2.59A1-863[»]
5M7MX-ray2.70A1-863[»]
5MHPX-ray2.43A1-863[»]
ProteinModelPortaliQ13822
SMRiQ13822
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111194, 3 interactors
IntActiQ13822, 2 interactors
MINTiQ13822

Chemistry databases

BindingDBiQ13822
ChEMBLiCHEMBL3691
GuidetoPHARMACOLOGYi2901
SwissLipidsiSLP:000000393
SLP:000000641 [Q13822-1]

PTM databases

GlyConnecti1197
iPTMnetiQ13822
PhosphoSitePlusiQ13822

Polymorphism and mutation databases

BioMutaiENPP2
DMDMi290457674

Proteomic databases

PeptideAtlasiQ13822
PRIDEiQ13822
ProteomicsDBi59692
59693 [Q13822-2]
59694 [Q13822-3]

Protocols and materials databases

DNASUi5168
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000075322; ENSP00000075322; ENSG00000136960 [Q13822-1]
ENST00000259486; ENSP00000259486; ENSG00000136960 [Q13822-2]
ENST00000522826; ENSP00000428291; ENSG00000136960 [Q13822-3]
GeneIDi5168
KEGGihsa:5168
UCSCiuc003yos.3 human [Q13822-1]

Organism-specific databases

CTDi5168
DisGeNETi5168
EuPathDBiHostDB:ENSG00000136960.12
GeneCardsiENPP2
H-InvDBiHIX0025550
HGNCiHGNC:3357 ENPP2
HPAiHPA023700
HPA053652
MIMi601060 gene
neXtProtiNX_Q13822
OpenTargetsiENSG00000136960
PharmGKBiPA27792
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119157
HOVERGENiHBG051484
InParanoidiQ13822
KOiK01122
OMAiDGLHDTQ
OrthoDBiEOG091G017X
PhylomeDBiQ13822
TreeFamiTF330032

Enzyme and pathway databases

BioCyciMetaCyc:HS06258-MONOMER
BRENDAi3.1.4.39 2681
ReactomeiR-HSA-199220 Vitamin B5 (pantothenate) metabolism
SABIO-RKiQ13822

Miscellaneous databases

ChiTaRSiENPP2 human
GeneWikiiAutotaxin
GenomeRNAii5168
PROiPR:Q13822
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000136960 Expressed in 235 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_ENPP2
ExpressionAtlasiQ13822 baseline and differential
GenevisibleiQ13822 HS

Family and domain databases

Gene3Di3.40.720.10, 1 hit
InterProiView protein in InterPro
IPR017849 Alkaline_Pase-like_a/b/a
IPR017850 Alkaline_phosphatase_core_sf
IPR001604 DNA/RNA_non-sp_Endonuclease
IPR029881 ENPP2
IPR020821 Extracellular_endonuc_su_A
IPR002591 Phosphodiest/P_Trfase
IPR036024 Somatomedin_B-like_dom_sf
IPR020436 Somatomedin_B_chordata
IPR001212 Somatomedin_B_dom
PANTHERiPTHR10151:SF21 PTHR10151:SF21, 1 hit
PfamiView protein in Pfam
PF01223 Endonuclease_NS, 1 hit
PF01663 Phosphodiest, 1 hit
PF01033 Somatomedin_B, 2 hits
PRINTSiPR00022 SOMATOMEDINB
SMARTiView protein in SMART
SM00892 Endonuclease_NS, 1 hit
SM00477 NUC, 1 hit
SM00201 SO, 2 hits
SUPFAMiSSF53649 SSF53649, 1 hit
SSF90188 SSF90188, 2 hits
PROSITEiView protein in PROSITE
PS00524 SMB_1, 2 hits
PS50958 SMB_2, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiENPP2_HUMAN
AccessioniPrimary (citable) accession number: Q13822
Secondary accession number(s): A8UHA1
, E9PHP7, Q13827, Q14555, Q15117, Q9UCQ8, Q9UCR0, Q9UCR1, Q9UCR2, Q9UCR3, Q9UCR4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: March 2, 2010
Last modified: November 7, 2018
This is version 172 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again