UniProtKB - Q13822 (ENPP2_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
>sp|Q13822|ENPP2_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens OX=9606 GN=ENPP2 PE=1 SV=3 MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR KTSRSYPEILTLKTYLHTYESEICommunity curation ()Add a publicationFeedback
Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
ENPP2
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
- Ref.13"Potential involvement of adipocyte insulin resistance in obesity-associated up-regulation of adipocyte lysophospholipase D/autotaxin expression."
Boucher J., Quilliot D., Pradere J.P., Simon M.F., Gres S., Guigne C., Prevot D., Ferry G., Boutin J.A., Carpene C., Valet P., Saulnier-Blache J.S.
Diabetologia 48:569-577(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION, POSSIBLE FUNCTION IN OBESITY.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.4"Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1-phosphate."
van Meeteren L.A., Ruurs P., Christodoulou E., Goding J.W., Takakusa H., Kikuchi K., Perrakis A., Nagano T., Moolenaar W.H.
J. Biol. Chem. 280:21155-21161(2005) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, ACTIVITY REGULATION, VARIANT PRO-493. - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.9"Identification, purification, and partial sequence analysis of autotaxin, a novel motility-stimulating protein."
Stracke M.L., Krutzsch H.C., Unsworth E.J., Aarestad A., Cioce V., Schiffmann E., Liotta L.A.
J. Biol. Chem. 267:2524-2529(1992) [PubMed] [Europe PMC] [Abstract] - Ref.10"Autotaxin (NPP-2), a metastasis-enhancing mitogen, is an angiogenic factor."
Nam S.W., Clair T., Kim Y.S., McMarlin A., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 61:6938-6944(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION IN ANGIOGENESIS. - Ref.11"Serum lysophosphatidic acid is produced through diverse phospholipase pathways."
Aoki J., Taira A., Takanezawa Y., Kishi Y., Hama K., Kishimoto T., Mizuno K., Saku K., Taguchi R., Arai H.
J. Biol. Chem. 277:48737-48744(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360. - Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307. - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi
- 1-O-alkyl-sn-glycero-3-phosphoethanolamineEC:3.1.4.39
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.4"Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1-phosphate."
van Meeteren L.A., Ruurs P., Christodoulou E., Goding J.W., Takakusa H., Kikuchi K., Perrakis A., Nagano T., Moolenaar W.H.
J. Biol. Chem. 280:21155-21161(2005) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, ACTIVITY REGULATION, VARIANT PRO-493. - Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307. - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion based on experiment ini
- Ref.4"Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1-phosphate."
van Meeteren L.A., Ruurs P., Christodoulou E., Goding J.W., Takakusa H., Kikuchi K., Perrakis A., Nagano T., Moolenaar W.H.
J. Biol. Chem. 280:21155-21161(2005) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, ACTIVITY REGULATION, VARIANT PRO-493. - Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307. - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-O-alkyl-sn-glycero-3-phosphoethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-O-alkyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-O-(9Z-octadecenyl)-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-O-(9Z-octadecenyl)-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-O-(9Z-octadecenyl)-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- a 2-acyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a 2-acyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=a 2-acyl-sn-glycerol 3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- a 2-acyl-sn-glycero-3-phospho-L-serine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a 2-acyl-sn-glycero-3-phospho-L-serine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=a 2-acyl-sn-glycerol 3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+L-serine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- 1-dodecanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-dodecanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-dodecanoyl-sn-glycerol 3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H2O
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+sphing-4-enine-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+sphing-4-enine 1-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
- a 1-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a 1-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-tetradecanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-tetradecanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-tetradecanoyl-sn-glycerol 3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-decanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-decanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-decanoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-hexadecanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-hexadecanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-hexadecanoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-octadecanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-octadecanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-octadecanoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-O-hexadecyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-O-hexadecyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-O-hexadecyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-hexanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-hexanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-hexanoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1,2-dioctanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1,2-dioctanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1,2-dioctanoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1,2-didecanoyl-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1,2-didecanoyl-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1,2-didecanoyl-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-O-(1Z-alkenyl)-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+choline- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
<p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred from sequence similarity toi
direction.Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+ethanolamine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phospho-L-serine
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred from sequence similarity toi
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred from sequence similarity toi
direction.Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
1-(9Z-octadecenoyl)-sn-glycero-3-phospho-L-serine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H2O- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
=1-(9Z-octadecenoyl)-sn-glycero-3-phosphate- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+L-serine- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori
Protein has several cofactor binding sites:- Zn2+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.17"Discovery of 2-[[2-Ethyl-6-[4-[2-(3-hydroxyazetidin-1-yl)-2-oxoethyl]piperazin-1-yl]-8-methylimidazo[1,2-a]pyridin-3-yl]methylamino]-4-(4-fluorophenyl)thiazole-5-carbonitrile (GLPG1690), a First-in-Class Autotaxin Inhibitor Undergoing Clinical Evaluation for the Treatment of Idiopathic Pulmonary Fibrosis."
Desroy N., Housseman C., Bock X., Joncour A., Bienvenu N., Cherel L., Labeguere V., Rondet E., Peixoto C., Grassot J.M., Picolet O., Annoot D., Triballeau N., Monjardet A., Wakselman E., Roncoroni V., Le Tallec S., Blanque R. , Cottereaux C., Vandervoort N., Christophe T., Mollat P., Lamers M., Auberval M., Hrvacic B., Ralic J., Oste L., van der Aar E., Brys R., Heckmann B.
J. Med. Chem. 60:3580-3590(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.43 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, COFACTOR, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
Manual assertion based on experiment ini
- Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.17"Discovery of 2-[[2-Ethyl-6-[4-[2-(3-hydroxyazetidin-1-yl)-2-oxoethyl]piperazin-1-yl]-8-methylimidazo[1,2-a]pyridin-3-yl]methylamino]-4-(4-fluorophenyl)thiazole-5-carbonitrile (GLPG1690), a First-in-Class Autotaxin Inhibitor Undergoing Clinical Evaluation for the Treatment of Idiopathic Pulmonary Fibrosis."
Desroy N., Housseman C., Bock X., Joncour A., Bienvenu N., Cherel L., Labeguere V., Rondet E., Peixoto C., Grassot J.M., Picolet O., Annoot D., Triballeau N., Monjardet A., Wakselman E., Roncoroni V., Le Tallec S., Blanque R. , Cottereaux C., Vandervoort N., Christophe T., Mollat P., Lamers M., Auberval M., Hrvacic B., Ralic J., Oste L., van der Aar E., Brys R., Heckmann B.
J. Med. Chem. 60:3580-3590(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.43 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, COFACTOR, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
- Ca2+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.17"Discovery of 2-[[2-Ethyl-6-[4-[2-(3-hydroxyazetidin-1-yl)-2-oxoethyl]piperazin-1-yl]-8-methylimidazo[1,2-a]pyridin-3-yl]methylamino]-4-(4-fluorophenyl)thiazole-5-carbonitrile (GLPG1690), a First-in-Class Autotaxin Inhibitor Undergoing Clinical Evaluation for the Treatment of Idiopathic Pulmonary Fibrosis."
Desroy N., Housseman C., Bock X., Joncour A., Bienvenu N., Cherel L., Labeguere V., Rondet E., Peixoto C., Grassot J.M., Picolet O., Annoot D., Triballeau N., Monjardet A., Wakselman E., Roncoroni V., Le Tallec S., Blanque R. , Cottereaux C., Vandervoort N., Christophe T., Mollat P., Lamers M., Auberval M., Hrvacic B., Ralic J., Oste L., van der Aar E., Brys R., Heckmann B.
J. Med. Chem. 60:3580-3590(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.43 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, COFACTOR, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
Manual assertion based on experiment ini
- Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.17"Discovery of 2-[[2-Ethyl-6-[4-[2-(3-hydroxyazetidin-1-yl)-2-oxoethyl]piperazin-1-yl]-8-methylimidazo[1,2-a]pyridin-3-yl]methylamino]-4-(4-fluorophenyl)thiazole-5-carbonitrile (GLPG1690), a First-in-Class Autotaxin Inhibitor Undergoing Clinical Evaluation for the Treatment of Idiopathic Pulmonary Fibrosis."
Desroy N., Housseman C., Bock X., Joncour A., Bienvenu N., Cherel L., Labeguere V., Rondet E., Peixoto C., Grassot J.M., Picolet O., Annoot D., Triballeau N., Monjardet A., Wakselman E., Roncoroni V., Le Tallec S., Blanque R. , Cottereaux C., Vandervoort N., Christophe T., Mollat P., Lamers M., Auberval M., Hrvacic B., Ralic J., Oste L., van der Aar E., Brys R., Heckmann B.
J. Med. Chem. 60:3580-3590(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.43 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, COFACTOR, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi
Manual assertion inferred by curator fromi
- Ref.4"Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1-phosphate."
van Meeteren L.A., Ruurs P., Christodoulou E., Goding J.W., Takakusa H., Kikuchi K., Perrakis A., Nagano T., Moolenaar W.H.
J. Biol. Chem. 280:21155-21161(2005) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, ACTIVITY REGULATION, VARIANT PRO-493. - Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi
- KM=0.5 mM for 16:0-LPC (at pH 8.5)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- KM=5.5 mM for pNP-TMP (at pH 8.5)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- KM=11.3 mM for pNppp (isoform 1)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- KM=5.7 mM for pNppp (isoform 2)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- KM=19.8 mM for pNppp (isoform 3)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- KM=96 µM for sn-1 lyso-PAF1 Publication
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=51 µM for sn-2 lyso-PAF1 Publication
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- KM=0.10 mM for lysophosphatidylcholine1 Publication
Manual assertion based on experiment ini
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
- KM=0.23 mM for sphingosylphosphorylcholine1 Publication
Manual assertion based on experiment ini
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
- Vmax=1.9 nmol/min/µg enzyme with pNppp as substrate (isoform 1)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- Vmax=0.67 nmol/min/µg enzyme with pNppp as substrate (isoform 2)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- Vmax=1.6 nmol/min/µg enzyme with pNppp as substrate (isoform 3)2 Publications
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
- Vmax=0.11 µmol/min/mg enzyme with sn-1 lyso-PAF as substrate1 Publication
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=0.025 µmol/min/mg enzyme with sn-2 lyso-PAF as substrate1 Publication
Manual assertion based on experiment ini
- Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES.
- Vmax=11.8 nmol/min/µg enzyme with lysophosphatidylcholine as substrate1 Publication
Manual assertion based on experiment ini
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
- Vmax=6.1 nmol/min/µg enzyme with sphingosylphosphorylcholine as substrate1 Publication
Manual assertion based on experiment ini
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
pH dependencei
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Temperature dependencei
Manual assertion based on experiment ini
- Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract]
Sites
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi | 172 | Zinc 1; catalyticCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei | 210 | NucleophileBy similarity Manual assertion inferred from sequence similarity toi | 1 | |
Metal bindingi | 210 | Zinc 1; catalyticCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei | 231 | SubstrateCombined sources Manual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion inferred by curator fromi
| 1 | |
Binding sitei | 307 | SubstrateBy similarity Manual assertion inferred from sequence similarity toi | 1 | |
Metal bindingi | 312 | Zinc 2; catalyticCombined sources Manual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| 1 | |
Metal bindingi | 316 | Zinc 2; via tele nitrogen; catalyticCombined sources Manual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| 1 | |
Metal bindingi | 359 | Zinc 1; catalyticCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
Metal bindingi | 360 | Zinc 1; via tele nitrogen; catalyticCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
Metal bindingi | 475 | Zinc 2; via tele nitrogen; catalyticCombined sources Manual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| 1 | |
Metal bindingi | 740 | CalciumCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
Metal bindingi | 742 | CalciumCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
Metal bindingi | 744 | CalciumCombined sources Manual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| 1 | |
Metal bindingi | 746 | Calcium; via carbonyl oxygenCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
Metal bindingi | 748 | CalciumCombined sources Manual assertion inferred from combination of experimental and computational evidencei 2 PublicationsManual assertion based on experiment ini
| 1 | |
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei | 853 | Essential for catalytic activityBy similarity Manual assertion inferred from sequence similarity toi | 1 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- alkylglycerophosphoethanolamine phosphodiesterase activity Source: GO_Central
<p>Inferred from Biological aspect of Ancestor</p>
<p>A type of phylogenetic evidence whereby an aspect of a descendent is inferred through the characterization of an aspect of a ancestral gene.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#iba">GO evidence code guide</a></p>
Inferred from biological aspect of ancestori
- "Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium."
Gaudet P., Livstone M.S., Lewis S.E., Thomas P.D.
Brief Bioinform 12:449-462(2011) [PubMed] [Europe PMC] [Abstract]
- calcium ion binding Source: UniProtKB
<p>Inferred from Direct Assay</p>
<p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#ida">GO evidence code guide</a></p>
Inferred from direct assayi
- Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS.
- hydrolase activity Source: UniProtKB
<p>Traceable Author Statement</p>
<p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#tas">GO evidence code guide</a></p>
Traceable author statementi
- Ref.1"cDNA cloning of the human tumor motility-stimulating protein, autotaxin, reveals a homology with phosphodiesterases."
Murata J., Lee H.Y., Clair T., Krutzsch H.C., Arestad A.A., Sobel M.E., Liotta L.A., Stracke M.L.
J. Biol. Chem. 269:30479-30484(1994) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE, CHARACTERIZATION, VARIANT PRO-493.
- lysophospholipase activity Source: UniProtKBInferred from direct assayi
- Ref.11"Serum lysophosphatidic acid is produced through diverse phospholipase pathways."
Aoki J., Taira A., Takanezawa Y., Kishi Y., Hama K., Kishimoto T., Mizuno K., Saku K., Taguchi R., Arai H.
J. Biol. Chem. 277:48737-48744(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360. - "Prostatic acid phosphatase degrades lysophosphatidic acid in seminal plasma."
Tanaka M., Kishi Y., Takanezawa Y., Kakehi Y., Aoki J., Arai H.
FEBS Lett. 571:197-204(2004) [PubMed] [Europe PMC] [Abstract] - Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307. - Ref.14"The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation."
Bolen A.L., Naren A.P., Yarlagadda S., Beranova-Giorgianni S., Chen L., Norman D., Baker D.L., Rowland M.M., Best M.D., Sano T., Tsukahara T., Liliom K., Igarashi Y., Tigyi G.
J. Lipid Res. 52:958-970(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS.
- nucleic acid binding Source: InterPro
- nucleotide diphosphatase activity Source: InterPro
- phosphodiesterase I activity Source: GO_CentralInferred from biological aspect of ancestori
- "Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium."
Gaudet P., Livstone M.S., Lewis S.E., Thomas P.D.
Brief Bioinform 12:449-462(2011) [PubMed] [Europe PMC] [Abstract]
- polysaccharide binding Source: InterPro
- scavenger receptor activity Source: InterPro
- transcription factor binding Source: ProtIncTraceable author statementi
- Ref.2"Molecular cloning and chromosomal assignment of the human brain-type phosphodiesterase I/nucleotide pyrophosphatase gene (PDNP2)."
Kawagoe H., Soma O., Goji J., Nishimura N., Narita M., Inazawa J., Nakamura H., Sano K.
Genomics 30:380-384(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-45, TISSUE SPECIFICITY, VARIANT PRO-493.
- zinc ion binding Source: UniProtKBInferred from direct assayi
- Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS.
GO - Biological processi
- cell motility Source: UniProtKBTraceable author statementi
- Ref.9"Identification, purification, and partial sequence analysis of autotaxin, a novel motility-stimulating protein."
Stracke M.L., Krutzsch H.C., Unsworth E.J., Aarestad A., Cioce V., Schiffmann E., Liotta L.A.
J. Biol. Chem. 267:2524-2529(1992) [PubMed] [Europe PMC] [Abstract]
- chemotaxis Source: UniProtKB
<p>Non-traceable Author Statement</p>
<p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#nas">GO evidence code guide</a></p>
Non-traceable author statementi
- Ref.1"cDNA cloning of the human tumor motility-stimulating protein, autotaxin, reveals a homology with phosphodiesterases."
Murata J., Lee H.Y., Clair T., Krutzsch H.C., Arestad A.A., Sobel M.E., Liotta L.A., Stracke M.L.
J. Biol. Chem. 269:30479-30484(1994) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE, CHARACTERIZATION, VARIANT PRO-493.
- immune response Source: InterPro
- phosphatidylcholine catabolic process Source: UniProtKBInferred from direct assayi
- Ref.15"Structural basis of substrate discrimination and integrin binding by autotaxin."
Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. , Smyth S.S., Ovaa H., Bollen M., Morris A.J., Moolenaar W.H., Perrakis A.
Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307.
- phospholipid catabolic process Source: UniProtKBInferred from direct assayi
- "Prostatic acid phosphatase degrades lysophosphatidic acid in seminal plasma."
Tanaka M., Kishi Y., Takanezawa Y., Kakehi Y., Aoki J., Arai H.
FEBS Lett. 571:197-204(2004) [PubMed] [Europe PMC] [Abstract] - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS.
- positive regulation of epithelial cell migration Source: UniProtKB
<p>Inferred from Mutant Phenotype</p>
<p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#imp">GO evidence code guide</a></p>
Inferred from mutant phenotypei
- "Autotaxin and lysophosphatidic acid stimulate intestinal cell motility by redistribution of the actin modifying protein villin to the developing lamellipodia."
Khurana S., Tomar A., George S.P., Wang Y., Siddiqui M.R., Guo H., Tigyi G., Mathew S.
Exp. Cell Res. 314:530-542(2008) [PubMed] [Europe PMC] [Abstract]
- positive regulation of lamellipodium morphogenesis Source: UniProtKB
<p>Inferred from Genetic Interaction</p>
<p>Used to describe "traditional" genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#igi">GO evidence code guide</a></p>
Inferred from genetic interactioni
- "Autotaxin and lysophosphatidic acid stimulate intestinal cell motility by redistribution of the actin modifying protein villin to the developing lamellipodia."
Khurana S., Tomar A., George S.P., Wang Y., Siddiqui M.R., Guo H., Tigyi G., Mathew S.
Exp. Cell Res. 314:530-542(2008) [PubMed] [Europe PMC] [Abstract]
- positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKBInferred from direct assayi
- "Autotaxin and lysophosphatidic acid stimulate intestinal cell motility by redistribution of the actin modifying protein villin to the developing lamellipodia."
Khurana S., Tomar A., George S.P., Wang Y., Siddiqui M.R., Guo H., Tigyi G., Mathew S.
Exp. Cell Res. 314:530-542(2008) [PubMed] [Europe PMC] [Abstract]
- regulation of angiogenesis Source: InterPro
- regulation of cell migration Source: UniProtKBInferred from direct assayi
- Ref.9"Identification, purification, and partial sequence analysis of autotaxin, a novel motility-stimulating protein."
Stracke M.L., Krutzsch H.C., Unsworth E.J., Aarestad A., Cioce V., Schiffmann E., Liotta L.A.
J. Biol. Chem. 267:2524-2529(1992) [PubMed] [Europe PMC] [Abstract]
- sphingolipid catabolic process Source: UniProtKBInferred from direct assayi
- Ref.12"Autotaxin hydrolyzes sphingosylphosphorylcholine to produce the regulator of migration, sphingosine-1-phosphate."
Clair T., Aoki J., Koh E., Bandle R.W., Nam S.W., Ptaszynska M.M., Mills G.B., Schiffmann E., Liotta L.A., Stracke M.L.
Cancer Res. 63:5446-5453(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF THR-210; HIS-316 AND HIS-360.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
Molecular function | Hydrolase |
Biological process | Chemotaxis, Lipid degradation, Lipid metabolism |
Ligand | Calcium, Metal-binding, Zinc |
Enzyme and pathway databases
BioCyc Collection of Pathway/Genome Databases More...BioCyci | MetaCyc:HS06258-MONOMER |
BRENDA Comprehensive Enzyme Information System More...BRENDAi | 3.1.4.39, 2681 |
Pathway Commons web resource for biological pathway data More...PathwayCommonsi | Q13822 |
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-HSA-199220, Vitamin B5 (pantothenate) metabolism |
SABIO-RK: Biochemical Reaction Kinetics Database More...SABIO-RKi | Q13822 |
Chemistry databases
SwissLipids knowledge resource for lipid biology More...SwissLipidsi | SLP:000000393 SLP:000000641 [Q13822-1] |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 (EC:3.1.4.39
Manual assertion based on experiment ini
Short name: E-NPP 2 Alternative name(s): Autotaxin2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
Extracellular lysophospholipase D Short name: LysoPLD1 Publication Manual assertion based on opinion ini
|
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:ENPP2 Synonyms:ATX2 Publications Manual assertion based on opinion ini
Manual assertion based on opinion ini
|
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Human Gene Nomenclature Database More...HGNCi | HGNC:3357, ENPP2 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 601060, gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q13822 |
Eukaryotic Pathogen, Vector and Host Database Resources More...VEuPathDBi | HostDB:ENSG00000136960.12 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Extracellular region or secreted
- Secreted 5 Publications
Manual assertion based on experiment ini
- Ref.4"Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1-phosphate."
van Meeteren L.A., Ruurs P., Christodoulou E., Goding J.W., Takakusa H., Kikuchi K., Perrakis A., Nagano T., Moolenaar W.H.
J. Biol. Chem. 280:21155-21161(2005) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, ACTIVITY REGULATION, VARIANT PRO-493. - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.9"Identification, purification, and partial sequence analysis of autotaxin, a novel motility-stimulating protein."
Stracke M.L., Krutzsch H.C., Unsworth E.J., Aarestad A., Cioce V., Schiffmann E., Liotta L.A.
J. Biol. Chem. 267:2524-2529(1992) [PubMed] [Europe PMC] [Abstract] - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS. - Ref.18"Selective Inhibition of Autotaxin Is Efficacious in Mouse Models of Liver Fibrosis."
Bain G., Shannon K.E., Huang F., Darlington J., Goulet L., Prodanovich P., Ma G.L., Santini A.M., Stein A.J., Lonergan D., King C.D., Calderon I., Lai A., Hutchinson J.H., Evans J.F.
J. Pharmacol. Exp. Ther. 360:1-13(2017) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (2.59 ANGSTROMS) IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, DISULFIDE BONDS.
- Secreted 5 Publications
Extracellular region or secreted
- extracellular space Source: UniProtKBInferred from direct assayi
- "Prostatic acid phosphatase degrades lysophosphatidic acid in seminal plasma."
Tanaka M., Kishi Y., Takanezawa Y., Kakehi Y., Aoki J., Arai H.
FEBS Lett. 571:197-204(2004) [PubMed] [Europe PMC] [Abstract] - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS.
- extracellular space Source: UniProtKBInferred from direct assayi
Plasma Membrane
- plasma membrane Source: ProtIncTraceable author statementi
- Ref.3"Cloning, chromosomal localization, and tissue expression of autotaxin from human teratocarcinoma cells."
Lee H.Y., Murata J., Clair T., Polymeropoulos M.H., Torres R., Manrow R.E., Liotta L.A., Stracke M.L.
Biochem. Biophys. Res. Commun. 218:714-719(1996) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT PRO-493.
- plasma membrane Source: ProtIncTraceable author statementi
Keywords - Cellular componenti
Secreted<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Mutagenesis
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 170 | S → E: Reduces lysophospholipase activity by about 70%. | 1 | |
Mutagenesisi | 210 | T → A: Loss of lysophospholipase activity and ability to hydrolyze sphingosylphosphorylcholine. 2 Publications Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 211 | F → Y: Reduces lysophospholipase activity by about 70%. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 218 | A → V: Reduces lysophospholipase activity by about 50%. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 231 | N → A: Strongly reduced lysophospholipase activity. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 307 | Y → Q: Reduces lysophospholipase activity by about 70%. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 316 | H → Q: Loss of ability to hydrolyze sphingosylphosphorylcholine. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 360 | H → Q: Loss of ability to hydrolyze sphingosylphosphorylcholine. 1 Publication Manual assertion based on experiment ini
| 1 |
Keywords - Diseasei
ObesityOrganism-specific databases
DisGeNET More...DisGeNETi | 5168 |
Open Targets More...OpenTargetsi | ENSG00000136960 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27792 |
Miscellaneous databases
Pharos NIH Druggable Genome Knowledgebase More...Pharosi | Q13822, Tchem |
Chemistry databases
ChEMBL database of bioactive drug-like small molecules More...ChEMBLi | CHEMBL3691 |
DrugCentral More...DrugCentrali | Q13822 |
IUPHAR/BPS Guide to PHARMACOLOGY More...GuidetoPHARMACOLOGYi | 2901 |
Genetic variation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | ENPP2 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 290457674 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei | 1 – 27 | By similarity Manual assertion inferred from sequence similarity toi Add BLAST | 27 | |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000281649 | 28 – 35 | Removed by furin2 Publications Manual assertion based on experiment ini
| 8 | |
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000188567 | 36 – 863 | Ectonucleotide pyrophosphatase/phosphodiesterase family member 2Add BLAST | 828 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 54 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 59 ↔ 76 | PROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 63 ↔ 94 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 74 ↔ 87 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 80 ↔ 86 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 103 ↔ 120 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 108 ↔ 138 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 118 ↔ 131 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 124 ↔ 130 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 149 ↔ 195 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 157 ↔ 351 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 367 ↔ 469 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Glycosylationi | 411 | N-linked (GlcNAc...) asparagineSequence analysis | 1 | |
Disulfide bondi | 414 ↔ 806 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Glycosylationi | 525 | N-linked (GlcNAc...) asparagineCombined sources Manual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| 1 | |
Disulfide bondi | 567 ↔ 667 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 569 ↔ 652 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Disulfide bondi | 775 ↔ 785 | PROSITE-ProRule annotation Manual assertion according to rulesi Combined sourcesManual assertion inferred from combination of experimental and computational evidencei 1 PublicationManual assertion based on experiment ini
| ||
Glycosylationi | 807 | N-linked (GlcNAc...) asparagineSequence analysis | 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
Manual assertion inferred from sequence similarity toi
Manual assertion inferred from sequence similarity toi
Keywords - PTMi
Cleavage on pair of basic residues, Disulfide bond, GlycoproteinProteomic databases
jPOST - Japan Proteome Standard Repository/Database More...jPOSTi | Q13822 |
MassIVE - Mass Spectrometry Interactive Virtual Environment More...MassIVEi | Q13822 |
PeptideAtlas More...PeptideAtlasi | Q13822 |
PRoteomics IDEntifications database More...PRIDEi | Q13822 |
ProteomicsDB: a multi-organism proteome resource More...ProteomicsDBi | 20576 59692 [Q13822-1] 59693 [Q13822-2] 59694 [Q13822-3] |
PTM databases
GlyConnect protein glycosylation platform More...GlyConnecti | 1197, 4 N-Linked glycans (1 site) |
GlyGen: Computational and Informatics Resources for Glycoscience More...GlyGeni | Q13822, 4 sites |
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q13822 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q13822 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Manual assertion based on experiment ini
- Ref.2"Molecular cloning and chromosomal assignment of the human brain-type phosphodiesterase I/nucleotide pyrophosphatase gene (PDNP2)."
Kawagoe H., Soma O., Goji J., Nishimura N., Narita M., Inazawa J., Nakamura H., Sano K.
Genomics 30:380-384(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-45, TISSUE SPECIFICITY, VARIANT PRO-493. - Ref.3"Cloning, chromosomal localization, and tissue expression of autotaxin from human teratocarcinoma cells."
Lee H.Y., Murata J., Clair T., Polymeropoulos M.H., Torres R., Manrow R.E., Liotta L.A., Stracke M.L.
Biochem. Biophys. Res. Commun. 218:714-719(1996) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT PRO-493. - Ref.5"Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization."
Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G.
J. Biol. Chem. 283:7776-7789(2008) [PubMed] [Europe PMC] [Abstract] - Ref.8"Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase."
Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K.
J. Biol. Chem. 277:39436-39442(2002) [PubMed] [Europe PMC] [Abstract] - Ref.16"Structural Basis for Inhibition of Human Autotaxin by Four Potent Compounds with Distinct Modes of Binding."
Stein A.J., Bain G., Prodanovich P., Santini A.M., Darlington J., Stelzer N.M., Sidhu R.S., Schaub J., Goulet L., Lonergan D., Calderon I., Evans J.F., Hutchinson J.H.
Mol. Pharmacol. 88:982-992(2015) [PubMed] [Europe PMC] [Abstract]Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 55-860 IN COMPLEX WITH SYNTHETIC INHIBITOR; CALCIUM AND ZINC, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-525, DISULFIDE BONDS.
<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni
Manual assertion based on experiment ini
- Ref.13"Potential involvement of adipocyte insulin resistance in obesity-associated up-regulation of adipocyte lysophospholipase D/autotaxin expression."
Boucher J., Quilliot D., Pradere J.P., Simon M.F., Gres S., Guigne C., Prevot D., Ferry G., Boutin J.A., Carpene C., Valet P., Saulnier-Blache J.S.
Diabetologia 48:569-577(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION, POSSIBLE FUNCTION IN OBESITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000136960, Expressed in pigmented layer of retina and 245 other tissues |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q13822, baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q13822, HS |
Organism-specific databases
Human Protein Atlas More...HPAi | ENSG00000136960, Tissue enhanced (brain, placenta) |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
GO - Molecular functioni
- transcription factor binding Source: ProtIncTraceable author statementi
- Ref.2"Molecular cloning and chromosomal assignment of the human brain-type phosphodiesterase I/nucleotide pyrophosphatase gene (PDNP2)."
Kawagoe H., Soma O., Goji J., Nishimura N., Narita M., Inazawa J., Nakamura H., Sano K.
Genomics 30:380-384(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-45, TISSUE SPECIFICITY, VARIANT PRO-493.
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGRID) More...BioGRIDi | 111194, 4 interactors |
Protein interaction database and analysis system More...IntActi | Q13822, 3 interactors |
Molecular INTeraction database More...MINTi | Q13822 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000259486 |
Chemistry databases
BindingDB database of measured binding affinities More...BindingDBi | Q13822 |
Miscellaneous databases
RNAct, Protein-RNA interaction predictions for model organisms. More...RNActi | Q13822, protein |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/structure%5Fsection">'Structure'</a> section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code 'T'.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 60 – 64 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
<p>This subsection of the <a href="http://www.uniprot.org/help/structure%5Fsection">'Structure'</a> section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 80 – 83 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 90 – 94 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
Turni | 99 – 101 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 105 – 107 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
<p>This subsection of the <a href="http://www.uniprot.org/help/structure%5Fsection">'Structure'</a> section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 116 – 119 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 121 – 123 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 124 – 127 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 134 – 138 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
Helixi | 144 – 146 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 166 – 172 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
Helixi | 176 – 181 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
Helixi | 182 – 185 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 187 – 195 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
Beta strandi | 196 – 198 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 210 – 219 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
Helixi | 223 – 226 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 230 – 235 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
Turni | 236 – 239 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 240 – 242 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 244 – 247 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 248 – 250 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 252 – 254 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 255 – 257 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 260 – 266 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
Beta strandi | 278 – 280 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 282 – 292 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 11 | |
Turni | 297 – 299 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 302 – 311 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
Helixi | 312 – 318 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
Helixi | 323 – 325 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 326 – 345 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 20 | |
Turni | 349 – 351 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 353 – 359 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
Beta strandi | 369 – 372 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 373 – 375 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 380 – 382 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 383 – 386 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 388 – 399 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 12 | |
Helixi | 405 – 412 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
Beta strandi | 413 – 416 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 420 – 425 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
Helixi | 426 – 428 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 431 – 433 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 443 – 448 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
Beta strandi | 453 – 457 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
Beta strandi | 472 – 474 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 482 – 484 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 488 – 492 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
Beta strandi | 497 – 500 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 506 – 508 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 509 – 516 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
Turni | 528 – 531 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 532 – 534 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 535 – 537 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 560 – 562 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 593 – 596 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 610 – 614 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
Beta strandi | 619 – 623 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
Turni | 624 – 627 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Beta strandi | 628 – 636 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
Helixi | 647 – 649 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 661 – 663 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 667 – 672 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
Beta strandi | 677 – 682 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
Helixi | 684 – 686 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Turni | 690 – 692 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 693 – 696 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 699 – 701 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 702 – 705 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 707 – 718 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 12 | |
Helixi | 720 – 728 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
Beta strandi | 730 – 738 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
Beta strandi | 744 – 746 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 750 – 752 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 766 – 777 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 12 | |
Helixi | 782 – 784 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Beta strandi | 789 – 797 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
Turni | 806 – 809 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 812 – 814 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
Helixi | 816 – 822 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
Helixi | 827 – 834 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
Beta strandi | 841 – 844 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
Helixi | 846 – 854 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 9 |
3D structure databases
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q13822 |
Database of comparative protein structure models More...ModBasei | Search... |
Protein Data Bank in Europe - Knowledge Base More...PDBe-KBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 55 – 98 | SMB 1PROSITE-ProRule annotation Manual assertion according to rulesi Add BLAST | 44 | |