Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13639 (5HT4R_HUMAN)

Protein

5-hydroxytryptamine receptor 4

Gene

HTR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • G protein-coupled receptor activity Source: GO_Central
  • G protein-coupled serotonin receptor activity Source: MGI
  • neurotransmitter receptor activity Source: GO_Central
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-390666 Serotonin receptors
R-HSA-418555 G alpha (s) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
5-hydroxytryptamine receptor 4
Short name:
5-HT-4
Short name:
5-HT4
Alternative name(s):
Serotonin receptor 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HTR4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000164270.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:5299 HTR4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602164 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13639

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 19ExtracellularBy similarityAdd BLAST19
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei20 – 40Helical; Name=1By similarityAdd BLAST21
Topological domaini41 – 58CytoplasmicBy similarityAdd BLAST18
Transmembranei59 – 79Helical; Name=2By similarityAdd BLAST21
Topological domaini80 – 93ExtracellularBy similarityAdd BLAST14
Transmembranei94 – 116Helical; Name=3By similarityAdd BLAST23
Topological domaini117 – 137CytoplasmicBy similarityAdd BLAST21
Transmembranei138 – 158Helical; Name=4By similarityAdd BLAST21
Topological domaini159 – 192ExtracellularBy similarityAdd BLAST34
Transmembranei193 – 213Helical; Name=5By similarityAdd BLAST21
Topological domaini214 – 260CytoplasmicBy similarityAdd BLAST47
Transmembranei261 – 281Helical; Name=6By similarityAdd BLAST21
Topological domaini282 – 294ExtracellularBy similarityAdd BLAST13
Transmembranei295 – 315Helical; Name=7By similarityAdd BLAST21
Topological domaini316 – 388CytoplasmicBy similarityAdd BLAST73

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3360

Open Targets

More...OpenTargetsi		ENSG00000164270

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29557

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1875

Drug and drug target database

More...DrugBanki		DB08810 Cinitapride
DB00604 Cisapride
DB01049 Ergoloid mesylate
DB01233 Metoclopramide
DB00904 Ondansetron
DB04873 Piboserod
DB06480 Prucalopride
DB04917 Renzapride
DB05905 TD-2749
DB05655 TD-5108
DB01079 Tegaserod
DB13025 Tiapride

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		9

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HTR4

Domain mapping of disease mutations (DMDM)

More...DMDMi		12644029

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000689651 – 3885-hydroxytryptamine receptor 4Add BLAST388

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi7N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi93 ↔ 184PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi329S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PeptideAtlas

More...PeptideAtlasi		Q13639

PRoteomics IDEntifications database

More...PRIDEi		Q13639

ProteomicsDB human proteome resource

More...ProteomicsDBi		59633
59634 [Q13639-2]
59635 [Q13639-3]
59636 [Q13639-4]
59637 [Q13639-5]
59638 [Q13639-6]
59639 [Q13639-7]
59640 [Q13639-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13639

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13639

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q13639

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000164270 Expressed in 208 organ(s), highest expression level in epithelium of bronchus

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13639 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13639 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA040591

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with PATJ, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR (By similarity). Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin).By similarity1 Publication

Protein-protein interaction databases

Molecular INTeraction database

More...MINTi		Q13639

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q13639

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1388
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q13639

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13639

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155983

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000239242

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG106962

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13639

KEGG Orthology (KO)

More...KOi		K04160

Identification of Orthologs from Complete Genome Data

More...OMAi		NIVDPFV

Database of Orthologous Groups

More...OrthoDBi		EOG091G06VI

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q13639

TreeFam database of animal gene trees

More...TreeFami		TF316350

Family and domain databases

Conserved Domains Database

More...CDDi		cd15056 7tmA_5-HT4, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001520 5HT4_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01059 5HT4RECEPTR
PR00237 GPCRRHODOPSN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 9 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 5-HT4(B) (identifier: Q13639-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDKLDANVSS EEGFGSVEKV VLLTFLSTVI LMAILGNLLV MVAVCWDRQL 
        60         70         80         90        100
RKIKTNYFIV SLAFADLLVS VLVMPFGAIE LVQDIWIYGE VFCLVRTSLD 
       110        120        130        140        150
VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPT 
       160        170        180        190        200
FISFLPIMQG WNNIGIIDLI EKRKFNQNSN STYCVFMVNK PYAITCSVVA 
       210        220        230        240        250
FYIPFLLMVL AYYRIYVTAK EHAHQIQMLQ RAGASSESRP QSADQHSTHR 
       260        270        280        290        300
MRTETKAAKT LCIIMGCFCL CWAPFFVTNI VDPFIDYTVP GQVWTAFLWL 
       310        320        330        340        350
GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYRRPSIL GQTVPCSTTT 
       360        370        380 
INGSTHVLRD AVECGGQWES QCHPPATSPL VAAQPSDT
Length:388
Mass (Da):43,761
Last modified:January 11, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7FCFEC60E7BDF560
GO
Isoform 5-HT4(A) (identifier: Q13639-2) [UniParc]FASTAAdd to basket
Also known as: 5-HT4S

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → YTVLHRGHHQELEKLPIHNDPESLESCF

Show »
Length:387
Mass (Da):44,109
Checksum:i43019BED75AC9D0F
GO
Isoform 5-HT4(C) (identifier: Q13639-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → F

Show »
Length:360
Mass (Da):40,944
Checksum:iF2BE6033F518178A
GO
Isoform 5-HT4(D) (identifier: Q13639-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRRNFGIRKRRLTKPS

Show »
Length:380
Mass (Da):43,186
Checksum:iC7591BFE6A9C1D62
GO
Isoform 5-HT4(E) (identifier: Q13639-5) [UniParc]FASTAAdd to basket
Also known as: H5-HT4(g)

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SGCSPVSSFLLLFCNRPVPV

Note: Mainly expressed in atria and cardiac ventricle.
Show »
Length:378
Mass (Da):42,746
Checksum:iE45038FEF832270D
GO
Isoform 5-HT4(F) (identifier: Q13639-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: L → LERSLNQGLGQDFHA

Show »
Length:402
Mass (Da):45,315
Checksum:i243F4AE87A6F77FA
GO
Isoform 5-HT4(G) (identifier: Q13639-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: Missing.

Show »
Length:359
Mass (Da):40,797
Checksum:iCE6033F518178AF3
GO
Isoform 5-HT4(I) (identifier: Q13639-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-359: R → RTDFLFDRDILARYWTKPARAGPFSGTLSIRCLTARKPVLG

Note: Expressed in all cardiovascular tissues analyzed.
Show »
Length:428
Mass (Da):48,255
Checksum:i463644AFC1C7D882
GO
Isoform 5-HT4c1 (identifier: Q13639-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRKK...GRKSCFREGK

Show »
Length:411
Mass (Da):46,907
Checksum:i7A842A2702C855D3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RK45E5RK45_HUMAN
5-hydroxytryptamine receptor 4
HTR4
371Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHV8E5RHV8_HUMAN
5-hydroxytryptamine receptor 4
HTR4
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06741227S → L in a patient with diffuse leukoencephalopathy with spheroids; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs199508638Ensembl.1
Natural variantiVAR_049364372C → Y. Corresponds to variant dbSNP:rs34826744Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001845169L → LERSLNQGLGQDFHA in isoform 5-HT4(F). Curated1
Alternative sequenceiVSP_001847359 – 388RDAVE…QPSDT → SSGTETDRRNFGIRKRRLTK PS in isoform 5-HT4(D). CuratedAdd BLAST30
Alternative sequenceiVSP_001846359 – 388RDAVE…QPSDT → SGCSPVSSFLLLFCNRPVPV in isoform 5-HT4(E). CuratedAdd BLAST30
Alternative sequenceiVSP_047862359 – 388RDAVE…QPSDT → SSGTETDRKKLWNKEEKIDQ TIQMPKRKRKKKASLSYEDL ILLGRKSCFREGK in isoform 5-HT4c1. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_043316359R → RTDFLFDRDILARYWTKPAR AGPFSGTLSIRCLTARKPVL G in isoform 5-HT4(I). Curated1
Alternative sequenceiVSP_001849360 – 388DAVEC…QPSDT → YTVLHRGHHQELEKLPIHND PESLESCF in isoform 5-HT4(A). CuratedAdd BLAST29
Alternative sequenceiVSP_001848360 – 388DAVEC…QPSDT → F in isoform 5-HT4(C). CuratedAdd BLAST29
Alternative sequenceiVSP_001850360 – 388Missing in isoform 5-HT4(G). CuratedAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y08756 mRNA Translation: CAA70002.1
Y12505 mRNA Translation: CAA73107.1
Y12506 mRNA Translation: CAA73108.1
Y12507 mRNA Translation: CAA73109.1
Y10437 mRNA Translation: CAA71462.1
Y13584 mRNA Translation: CAA73911.1
Y09586 mRNA Translation: CAA70774.1
AJ131724 mRNA Translation: CAC20411.1
AJ011371 mRNA Translation: CAA09600.1
AJ278979 mRNA Translation: CAC22248.1
AJ278980 mRNA Translation: CAC22249.1
AJ278981 mRNA Translation: CAC22250.1
AJ278982 mRNA Translation: CAC22251.1
AJ131725 mRNA Translation: CAC79533.1
AJ131726 mRNA Translation: CAC79538.1
AJ633645 mRNA Translation: CAG17627.1
AM712912 mRNA Translation: CAN84676.1
AC008627 Genomic DNA No translation available.
AC011390 Genomic DNA No translation available.
AC091971 Genomic DNA No translation available.
AC114939 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61800.1
CH471062 Genomic DNA Translation: EAW61801.1
CH471062 Genomic DNA Translation: EAW61804.1
BC074755 mRNA Translation: AAH74755.1
BC095497 mRNA Translation: AAH95497.1
AJ243213 Genomic DNA Translation: CAB71316.1
Z48150 mRNA Translation: CAA88167.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34270.1 [Q13639-2]
CCDS34271.1 [Q13639-5]
CCDS34272.1 [Q13639-8]
CCDS34273.2 [Q13639-3]
CCDS4291.1 [Q13639-1]
CCDS75353.1 [Q13639-9]

Protein sequence database of the Protein Information Resource

More...PIRi		S66493

NCBI Reference Sequences

More...RefSeqi		NP_000861.1, NM_000870.6 [Q13639-1]
NP_001035259.1, NM_001040169.2 [Q13639-2]
NP_001035262.2, NM_001040172.2 [Q13639-3]
NP_001035263.1, NM_001040173.2 [Q13639-8]
NP_001273339.1, NM_001286410.1 [Q13639-9]
NP_955525.1, NM_199453.3 [Q13639-5]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.483773

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000360693; ENSP00000353915; ENSG00000164270 [Q13639-8]
ENST00000362016; ENSP00000355037; ENSG00000164270 [Q13639-8]
ENST00000377888; ENSP00000367120; ENSG00000164270 [Q13639-1]
ENST00000517929; ENSP00000435904; ENSG00000164270 [Q13639-3]
ENST00000520514; ENSP00000427913; ENSG00000164270 [Q13639-9]
ENST00000521530; ENSP00000428320; ENSG00000164270 [Q13639-2]
ENST00000521735; ENSP00000430979; ENSG00000164270 [Q13639-5]
ENST00000522588; ENSP00000430874; ENSG00000164270 [Q13639-5]
ENST00000631296; ENSP00000485747; ENSG00000164270 [Q13639-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3360

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3360

UCSC genome browser

More...UCSCi		uc003lpn.5 human [Q13639-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08756 mRNA Translation: CAA70002.1
Y12505 mRNA Translation: CAA73107.1
Y12506 mRNA Translation: CAA73108.1
Y12507 mRNA Translation: CAA73109.1
Y10437 mRNA Translation: CAA71462.1
Y13584 mRNA Translation: CAA73911.1
Y09586 mRNA Translation: CAA70774.1
AJ131724 mRNA Translation: CAC20411.1
AJ011371 mRNA Translation: CAA09600.1
AJ278979 mRNA Translation: CAC22248.1
AJ278980 mRNA Translation: CAC22249.1
AJ278981 mRNA Translation: CAC22250.1
AJ278982 mRNA Translation: CAC22251.1
AJ131725 mRNA Translation: CAC79533.1
AJ131726 mRNA Translation: CAC79538.1
AJ633645 mRNA Translation: CAG17627.1
AM712912 mRNA Translation: CAN84676.1
AC008627 Genomic DNA No translation available.
AC011390 Genomic DNA No translation available.
AC091971 Genomic DNA No translation available.
AC114939 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61800.1
CH471062 Genomic DNA Translation: EAW61801.1
CH471062 Genomic DNA Translation: EAW61804.1
BC074755 mRNA Translation: AAH74755.1
BC095497 mRNA Translation: AAH95497.1
AJ243213 Genomic DNA Translation: CAB71316.1
Z48150 mRNA Translation: CAA88167.1
CCDSiCCDS34270.1 [Q13639-2]
CCDS34271.1 [Q13639-5]
CCDS34272.1 [Q13639-8]
CCDS34273.2 [Q13639-3]
CCDS4291.1 [Q13639-1]
CCDS75353.1 [Q13639-9]
PIRiS66493
RefSeqiNP_000861.1, NM_000870.6 [Q13639-1]
NP_001035259.1, NM_001040169.2 [Q13639-2]
NP_001035262.2, NM_001040172.2 [Q13639-3]
NP_001035263.1, NM_001040173.2 [Q13639-8]
NP_001273339.1, NM_001286410.1 [Q13639-9]
NP_955525.1, NM_199453.3 [Q13639-5]
UniGeneiHs.483773

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5EM9X-ray1.60B264-268[»]
ProteinModelPortaliQ13639
SMRiQ13639
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiQ13639

Chemistry databases

BindingDBiQ13639
ChEMBLiCHEMBL1875
DrugBankiDB08810 Cinitapride
DB00604 Cisapride
DB01049 Ergoloid mesylate
DB01233 Metoclopramide
DB00904 Ondansetron
DB04873 Piboserod
DB06480 Prucalopride
DB04917 Renzapride
DB05905 TD-2749
DB05655 TD-5108
DB01079 Tegaserod
DB13025 Tiapride
GuidetoPHARMACOLOGYi9

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

iPTMnetiQ13639
PhosphoSitePlusiQ13639
SwissPalmiQ13639

Polymorphism and mutation databases

BioMutaiHTR4
DMDMi12644029

Proteomic databases

PeptideAtlasiQ13639
PRIDEiQ13639
ProteomicsDBi59633
59634 [Q13639-2]
59635 [Q13639-3]
59636 [Q13639-4]
59637 [Q13639-5]
59638 [Q13639-6]
59639 [Q13639-7]
59640 [Q13639-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360693; ENSP00000353915; ENSG00000164270 [Q13639-8]
ENST00000362016; ENSP00000355037; ENSG00000164270 [Q13639-8]
ENST00000377888; ENSP00000367120; ENSG00000164270 [Q13639-1]
ENST00000517929; ENSP00000435904; ENSG00000164270 [Q13639-3]
ENST00000520514; ENSP00000427913; ENSG00000164270 [Q13639-9]
ENST00000521530; ENSP00000428320; ENSG00000164270 [Q13639-2]
ENST00000521735; ENSP00000430979; ENSG00000164270 [Q13639-5]
ENST00000522588; ENSP00000430874; ENSG00000164270 [Q13639-5]
ENST00000631296; ENSP00000485747; ENSG00000164270 [Q13639-1]
GeneIDi3360
KEGGihsa:3360
UCSCiuc003lpn.5 human [Q13639-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3360
DisGeNETi3360
EuPathDBiHostDB:ENSG00000164270.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		HTR4

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0078165
HGNCiHGNC:5299 HTR4
HPAiHPA040591
MIMi602164 gene
neXtProtiNX_Q13639
OpenTargetsiENSG00000164270
PharmGKBiPA29557

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000155983
HOGENOMiHOG000239242
HOVERGENiHBG106962
InParanoidiQ13639
KOiK04160
OMAiNIVDPFV
OrthoDBiEOG091G06VI
PhylomeDBiQ13639
TreeFamiTF316350

Enzyme and pathway databases

ReactomeiR-HSA-390666 Serotonin receptors
R-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HTR4 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		5-HT4_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3360

Protein Ontology

More...PROi		PR:Q13639

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000164270 Expressed in 208 organ(s), highest expression level in epithelium of bronchus
ExpressionAtlasiQ13639 baseline and differential
GenevisibleiQ13639 HS

Family and domain databases

CDDicd15056 7tmA_5-HT4, 1 hit
InterProiView protein in InterPro
IPR001520 5HT4_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01059 5HT4RECEPTR
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei5HT4R_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13639
Secondary accession number(s): C4WYH4
, Q546Q1, Q684M0, Q712M9, Q96KH9, Q96KI0, Q9H199, Q9NY73, Q9UBM6, Q9UBT4, Q9UE22, Q9UE23, Q9UQR6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: December 5, 2018
This is version 177 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again