Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (12 Aug 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cadherin-18

Gene

CDH18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q13634

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418990, Adherens junctions interactions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cadherin-18
Alternative name(s):
Cadherin-14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDH18
Synonyms:CDH14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000145526.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1757, CDH18

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603019, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13634

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini54 – 608ExtracellularSequence analysisAdd BLAST555
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei609 – 636HelicalSequence analysisAdd BLAST28
Topological domaini637 – 790CytoplasmicSequence analysisAdd BLAST154

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1016

Open Targets

More...
OpenTargetsi
ENSG00000145526

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26291

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q13634, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDH18

Domain mapping of disease mutations (DMDM)

More...
DMDMi
3023435

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000000381525 – 53Sequence analysisAdd BLAST29
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000381654 – 790Cadherin-18Add BLAST737

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi255N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi455N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi536N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei786PhosphoserineBy similarity1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q13634

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13634

PeptideAtlas

More...
PeptideAtlasi
Q13634

PRoteomics IDEntifications database

More...
PRIDEi
Q13634

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
59625 [Q13634-1]
59626 [Q13634-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q13634-1 [Q13634-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q13634, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13634

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13634

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145526, Expressed in cerebellum and 131 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13634, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13634, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000145526, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
107451, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q13634, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000425093

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q13634, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13634

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini54 – 159Cadherin 1PROSITE-ProRule annotationAdd BLAST106
Domaini160 – 268Cadherin 2PROSITE-ProRule annotationAdd BLAST109
Domaini269 – 383Cadherin 3PROSITE-ProRule annotationAdd BLAST115
Domaini384 – 486Cadherin 4PROSITE-ProRule annotationAdd BLAST103
Domaini487 – 608Cadherin 5PROSITE-ProRule annotationAdd BLAST122

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3594, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157512

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005284_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13634

KEGG Orthology (KO)

More...
KOi
K06805

Identification of Orthologs from Complete Genome Data

More...
OMAi
FNHLTQE

Database of Orthologous Groups

More...
OrthoDBi
240489at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13634

TreeFam database of animal gene trees

More...
TreeFami
TF329887

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.900.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039808, Cadherin
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
IPR000233, Cadherin_cytoplasmic-dom
IPR027397, Catenin_binding_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24027, PTHR24027, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00028, Cadherin, 5 hits
PF01049, Cadherin_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00205, CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00112, CA, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49313, SSF49313, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00232, CADHERIN_1, 3 hits
PS50268, CADHERIN_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13634-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKITSTSCIC PVLVCLCFVQ RCYGTAHHSS IKVMRNQTKH IEGETEVHHR
60 70 80 90 100
PKRGWVWNQF FVLEEHMGPD PQYVGKLHSN SDKGDGSVKY ILTGEGAGTI
110 120 130 140 150
FIIDDTTGDI HSTKSLDREQ KTHYVLHAQA IDRRTNKPLE PESEFIIKVQ
160 170 180 190 200
DINDNAPKFT DGPYIVTVPE MSDMGTSVLQ VTATDADDPT YGNSARVVYS
210 220 230 240 250
ILQGQPYFSV DPKTGVIRTA LHNMDREARE HYSVVIQAKD MAGQVGGLSG
260 270 280 290 300
STTVNITLTD VNDNPPRFPQ KHYQLYVPES AQVGSAVGKI KANDADTGSN
310 320 330 340 350
ADMTYSIING DGMGIFSIST DKETREGILS LKKPLNYEKK KSYTLNIEGA
360 370 380 390 400
NTHLDFRFSH LGPFKDATML KIIVGDVDEP PLFSMPSYLM EVYENAKIGT
410 420 430 440 450
VVGTVLAQDP DSTNSLVRYF INYNVEDDRF FNIDANTGTI RTTKVLDREE
460 470 480 490 500
TPWYNITVTA SEIDNPDLLS HVTVGIRVLD VNDNPPELAR EYDIIVCENS
510 520 530 540 550
KPGQVIHTIS ATDKDDFANG PRFNFFLDER LPVNPNFTLK DNEDNTASIL
560 570 580 590 600
TRRRRFSRTV QDVYYLPIMI SDGGIPSLSS SSTLTIRVCA CERDGRVRTC
610 620 630 640 650
HAEAFLSSAG LSTGALIAIL LCVLILLAIV VLFITLRRSK KEPLIISEED
660 670 680 690 700
VRENVVTYDD EGGGEEDTEA FDITALRNPS AAEELKYRRD IRPEVKLTPR
710 720 730 740 750
HQTSSTLESI DVQEFIKQRL AEADLDPSVP PYDSLQTYAY EGQRSEAGSI
760 770 780 790
SSLDSATTQS DQDYHYLGDW GPEFKKLAEL YGEIESERTT
Length:790
Mass (Da):88,073
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5C7BDEB229B6EDCA
GO
Isoform 2 (identifier: Q13634-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     544-790: DNTASILTRR...YGEIESERTT → AAAPSPSGFVHAREMGVCGPAMQKPSCPRLV

Show »
Length:574
Mass (Da):63,677
Checksum:iF40B25D51C3DADB4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RIH8D6RIH8_HUMAN
Cadherin-18
CDH18
590Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RER2D6RER2_HUMAN
Cadherin-18
CDH18
575Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAK3H0YAK3_HUMAN
Cadherin-18
CDH18
441Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti226R → G in AAH31051 (PubMed:15489334).Curated1
Sequence conflicti265P → T in AAH31051 (PubMed:15489334).Curated1
Sequence conflicti413T → I in AAH31051 (PubMed:15489334).Curated1
Sequence conflicti669E → G in AAH31051 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042308544 – 790DNTAS…SERTT → AAAPSPSGFVHAREMGVCGP AMQKPSCPRLV in isoform 2. 1 PublicationAdd BLAST247

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U59325 mRNA Translation: AAB02933.1
AK289547 mRNA Translation: BAF82236.1
AK295087 mRNA Translation: BAG58128.1
AC010490 Genomic DNA No translation available.
AC025173 Genomic DNA No translation available.
AC093221 Genomic DNA No translation available.
AC093303 Genomic DNA No translation available.
AC094103 Genomic DNA No translation available.
AC108128 Genomic DNA No translation available.
AC109474 Genomic DNA No translation available.
AC113350 Genomic DNA No translation available.
AC113397 Genomic DNA No translation available.
AC118463 Genomic DNA No translation available.
CH471168 Genomic DNA Translation: EAW68851.1
BC031051 mRNA Translation: AAH31051.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3889.1 [Q13634-1]
CCDS54835.1 [Q13634-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02678

NCBI Reference Sequences

More...
RefSeqi
NP_001161139.1, NM_001167667.1 [Q13634-2]
NP_001278885.1, NM_001291956.1 [Q13634-1]
NP_004925.1, NM_004934.3 [Q13634-1]
XP_005248285.1, XM_005248228.3 [Q13634-1]
XP_006714498.1, XM_006714435.3 [Q13634-1]
XP_016864413.1, XM_017008924.1 [Q13634-1]
XP_016864414.1, XM_017008925.1
XP_016864415.1, XM_017008926.1 [Q13634-1]
XP_016864416.1, XM_017008927.1 [Q13634-1]
XP_016864417.1, XM_017008928.1 [Q13634-1]
XP_016864418.1, XM_017008929.1 [Q13634-1]
XP_016864419.1, XM_017008930.1 [Q13634-1]
XP_016864420.1, XM_017008931.1
XP_016864421.1, XM_017008932.1
XP_016864428.1, XM_017008939.1
XP_016864429.1, XM_017008940.1
XP_016864430.1, XM_017008941.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000274170; ENSP00000274170; ENSG00000145526 [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526 [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526 [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526 [Q13634-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1016

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1016

UCSC genome browser

More...
UCSCi
uc003jgc.4, human [Q13634-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59325 mRNA Translation: AAB02933.1
AK289547 mRNA Translation: BAF82236.1
AK295087 mRNA Translation: BAG58128.1
AC010490 Genomic DNA No translation available.
AC025173 Genomic DNA No translation available.
AC093221 Genomic DNA No translation available.
AC093303 Genomic DNA No translation available.
AC094103 Genomic DNA No translation available.
AC108128 Genomic DNA No translation available.
AC109474 Genomic DNA No translation available.
AC113350 Genomic DNA No translation available.
AC113397 Genomic DNA No translation available.
AC118463 Genomic DNA No translation available.
CH471168 Genomic DNA Translation: EAW68851.1
BC031051 mRNA Translation: AAH31051.1
CCDSiCCDS3889.1 [Q13634-1]
CCDS54835.1 [Q13634-2]
PIRiG02678
RefSeqiNP_001161139.1, NM_001167667.1 [Q13634-2]
NP_001278885.1, NM_001291956.1 [Q13634-1]
NP_004925.1, NM_004934.3 [Q13634-1]
XP_005248285.1, XM_005248228.3 [Q13634-1]
XP_006714498.1, XM_006714435.3 [Q13634-1]
XP_016864413.1, XM_017008924.1 [Q13634-1]
XP_016864414.1, XM_017008925.1
XP_016864415.1, XM_017008926.1 [Q13634-1]
XP_016864416.1, XM_017008927.1 [Q13634-1]
XP_016864417.1, XM_017008928.1 [Q13634-1]
XP_016864418.1, XM_017008929.1 [Q13634-1]
XP_016864419.1, XM_017008930.1 [Q13634-1]
XP_016864420.1, XM_017008931.1
XP_016864421.1, XM_017008932.1
XP_016864428.1, XM_017008939.1
XP_016864429.1, XM_017008940.1
XP_016864430.1, XM_017008941.1

3D structure databases

SMRiQ13634
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107451, 4 interactors
IntActiQ13634, 1 interactor
STRINGi9606.ENSP00000425093

PTM databases

GlyGeniQ13634, 4 sites
iPTMnetiQ13634
PhosphoSitePlusiQ13634

Polymorphism and mutation databases

BioMutaiCDH18
DMDMi3023435

Proteomic databases

MassIVEiQ13634
PaxDbiQ13634
PeptideAtlasiQ13634
PRIDEiQ13634
ProteomicsDBi59625 [Q13634-1]
59626 [Q13634-2]
TopDownProteomicsiQ13634-1 [Q13634-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2730, 163 antibodies

The DNASU plasmid repository

More...
DNASUi
1016

Genome annotation databases

EnsembliENST00000274170; ENSP00000274170; ENSG00000145526 [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526 [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526 [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526 [Q13634-1]
GeneIDi1016
KEGGihsa:1016
UCSCiuc003jgc.4, human [Q13634-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1016
DisGeNETi1016
EuPathDBiHostDB:ENSG00000145526.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDH18
HGNCiHGNC:1757, CDH18
HPAiENSG00000145526, Tissue enriched (brain)
MIMi603019, gene
neXtProtiNX_Q13634
OpenTargetsiENSG00000145526
PharmGKBiPA26291

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3594, Eukaryota
GeneTreeiENSGT00940000157512
HOGENOMiCLU_005284_3_0_1
InParanoidiQ13634
KOiK06805
OMAiFNHLTQE
OrthoDBi240489at2759
PhylomeDBiQ13634
TreeFamiTF329887

Enzyme and pathway databases

PathwayCommonsiQ13634
ReactomeiR-HSA-418990, Adherens junctions interactions

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
1016, 1 hit in 870 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDH18, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1016
PharosiQ13634, Tdark

Protein Ontology

More...
PROi
PR:Q13634
RNActiQ13634, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000145526, Expressed in cerebellum and 131 other tissues
ExpressionAtlasiQ13634, baseline and differential
GenevisibleiQ13634, HS

Family and domain databases

Gene3Di4.10.900.10, 1 hit
InterProiView protein in InterPro
IPR039808, Cadherin
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
IPR000233, Cadherin_cytoplasmic-dom
IPR027397, Catenin_binding_dom_sf
PANTHERiPTHR24027, PTHR24027, 1 hit
PfamiView protein in Pfam
PF00028, Cadherin, 5 hits
PF01049, Cadherin_C, 1 hit
PRINTSiPR00205, CADHERIN
SMARTiView protein in SMART
SM00112, CA, 5 hits
SUPFAMiSSF49313, SSF49313, 5 hits
PROSITEiView protein in PROSITE
PS00232, CADHERIN_1, 3 hits
PS50268, CADHERIN_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAD18_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13634
Secondary accession number(s): A8K0I2, B4DHG6, Q8N5Z2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: August 12, 2020
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again