Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorting nexin-1

Gene

SNX1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in several stages of intracellular trafficking. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) (PubMed:12198132). Acts in part as component of the retromer membrane-deforming SNX-BAR subcomplex. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX-BAR subcomplex functions to deform the donor membrane into a tubular profile called endosome-to-TGN transport carrier (ETC) (Probable). Can sense membrane curvature and has in vitro vesicle-to-membrane remodeling activity (PubMed:19816406, PubMed:23085988). Involved in retrograde endosome-to-TGN transport of lysosomal enzyme receptors (IGF2R, M6PR and SORT1) and Shiginella dysenteria toxin stxB. Plays a role in targeting ligand-activated EGFR to the lysosomes for degradation after endocytosis from the cell surface and release from the Golgi (PubMed:12198132, PubMed:15498486, PubMed:17550970, PubMed:17101778, PubMed:18088323, PubMed:21040701). Involvement in retromer-independent endocytic trafficking of P2RY1 and lysosomal degradation of protease-activated receptor-1/F2R (PubMed:16407403, PubMed:20070609). Promotes KALRN- and RHOG-dependent but retromer-independent membrane remodeling such as lamellipodium formation; the function is dependent on GEF activity of KALRN (PubMed:20604901). Required for endocytosis of DRD5 upon agonist stimulation but not for basal receptor trafficking (PubMed:23152498).1 Publication12 Publications

Miscellaneous

Binds phosphatidylinositol 3-phosphate (PtdIns-3P) and phosphatidylinositol 3,5-bisphosphate (PtdIns-(3,5)P2) in liposome-based assays. Can bind PtdIns(3,4,5)P3 in protein:lipid overlay assays, but not in liposome-based assays.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei186Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei188Phosphatidylinositol 3-phosphate; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei214Phosphatidylinositol 3-phosphateBy similarity1
Binding sitei238Phosphatidylinositol 3-phosphateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q13596 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorting nexin-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNX1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000028528.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11172 SNX1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601272 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13596

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Endosome, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi214K → A: Abolishes phosphatidylinositol phosphate binding. Abolishes endosomal location. 2 Publications1
Mutagenesisi287 – 288MF → EE: Abolishes membrane remodeling capacity; no effect on dimerization. 1 Publication2
Mutagenesisi429 – 431KKR → EEE: Loss of endosomal location. 1 Publication3
Mutagenesisi442K → A: No effect on membrane remodeling and membrane binding; when associated with A-445. 1 Publication1
Mutagenesisi445K → A: No effect on membrane remodeling and membrane binding; when associated with A-442. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6642

Open Targets

More...
OpenTargetsi
ENSG00000028528

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36011

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SNX1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17380569

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002138351 – 522Sorting nexin-1Add BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei32PhosphoserineCombined sources1
Modified residuei39PhosphoserineCombined sources1
Modified residuei41PhosphothreonineBy similarity1
Modified residuei48PhosphothreonineCombined sources1
Modified residuei58PhosphoserineBy similarity1
Modified residuei72PhosphoserineCombined sources1
Modified residuei188PhosphoserineCombined sources1
Modified residuei237N6-acetyllysineCombined sources1
Modified residuei280PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13596

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13596

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13596

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13596

PeptideAtlas

More...
PeptideAtlasi
Q13596

PRoteomics IDEntifications database

More...
PRIDEi
Q13596

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59589
59590 [Q13596-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13596

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13596

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000028528 Expressed in 233 organ(s), highest expression level in left lobe of thyroid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_SNX1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13596 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13596 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047373
HPA052761

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Predominantly forms heterodimers with BAR domain-containing sorting nexins SNX5, SNX6 and SNX32; can self-associate to form homodimers (PubMed:23085988). The heterodimers are proposed to self-assemble into helical arrays on the membrane to stabilize and expand local membrane curvature underlying endosomal tubule formation. Thought to be a component of the originally described retromer complex (also called SNX-BAR retromer) which is a pentamer containing the heterotrimeric retromer cargo-selective complex (CSC), also described as vacuolar protein sorting subcomplex (VPS) and a heterodimeric membrane-deforming subcomplex formed between SNX1 or SNX2 and SNX5 or SNX6 (also called SNX-BAR subcomplex); the respective CSC and SNX-BAR subcomplexes associate with low affinity (Probable). Interacts with SNX5, SNX6, SNX32, VPS26A, VPS29, VPS35, DRD5, DENND5A, KALRN, RHOG (GDP-bound form) (PubMed:9819414, PubMed:11102511, PubMed:19619496, PubMed:19935774, PubMed:19619496, PubMed:20604901, PubMed:23085988, PubMed:23152498). The interaction with SNX2 is reported controversially (PubMed:9819414, PubMed:11997453, PubMed:19619496, PubMed:23085988). Interacts with DNAJC13; prevented by presence of HGS (PubMed:19874558). Interacts with HGS (By similarity).2 PublicationsBy similarity12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112525, 79 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q13596

Database of interacting proteins

More...
DIPi
DIP-398N

Protein interaction database and analysis system

More...
IntActi
Q13596, 41 interactors

Molecular INTeraction database

More...
MINTi
Q13596

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000453785

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1522
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2I4KNMR-A142-269[»]
4FZSX-ray2.80A/B301-522[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q13596

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13596

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q13596

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini143 – 272PXPROSITE-ProRule annotationAdd BLAST130
Domaini302 – 522BARAdd BLAST221

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni281 – 298Membrane-binding amphipathic helix1 PublicationAdd BLAST18

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The BAR domain is able to sense membrane curvature upon dimerization (PubMed:19816406). Membrane remodeling seems to implicate insertion of a N-terminal amphipatric helix (AH) in the membrane (Probable).1 Publication1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sorting nexin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2273 Eukaryota
COG5391 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155889

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293327

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000618

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13596

KEGG Orthology (KO)

More...
KOi
K17917

Identification of Orthologs from Complete Genome Data

More...
OMAi
AHPILQH

Database of Orthologous Groups

More...
OrthoDBi
947320at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13596

TreeFam database of animal gene trees

More...
TreeFami
TF313698

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07281 PX_SNX1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR001683 Phox
IPR036871 PX_dom_sf
IPR034901 PX_SNX1
IPR028660 SNX1
IPR039358 Sorting_nexin-like
IPR005329 Sorting_nexin_N
IPR015404 Vps5_C

The PANTHER Classification System

More...
PANTHERi
PTHR10555 PTHR10555, 1 hit
PTHR10555:SF129 PTHR10555:SF129, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00787 PX, 1 hit
PF03700 Sorting_nexin, 1 hit
PF09325 Vps5, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00312 PX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit
SSF64268 SSF64268, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50195 PX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13596-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASGGGGCSA SERLPPPFPG LEPESEGAAG GSEPEAGDSD TEGEDIFTGA
60 70 80 90 100
AVVSKHQSPK ITTSLLPINN GSKENGIHEE QDQEPQDLFA DATVELSLDS
110 120 130 140 150
TQNNQKKVLA KTLISLPPQE ATNSSKPQPT YEELEEEEQE DQFDLTVGIT
160 170 180 190 200
DPEKIGDGMN AYVAYKVTTQ TSLPLFRSKQ FAVKRRFSDF LGLYEKLSEK
210 220 230 240 250
HSQNGFIVPP PPEKSLIGMT KVKVGKEDSS SAEFLEKRRA ALERYLQRIV
260 270 280 290 300
NHPTMLQDPD VREFLEKEEL PRAVGTQTLS GAGLLKMFNK ATDAVSKMTI
310 320 330 340 350
KMNESDIWFE EKLQEVECEE QRLRKLHAVV ETLVNHRKEL ALNTAQFAKS
360 370 380 390 400
LAMLGSSEDN TALSRALSQL AEVEEKIEQL HQEQANNDFF LLAELLSDYI
410 420 430 440 450
RLLAIVRAAF DQRMKTWQRW QDAQATLQKK REAEARLLWA NKPDKLQQAK
460 470 480 490 500
DEILEWESRV TQYERDFERI STVVRKEVIR FEKEKSKDFK NHVIKYLETL
510 520
LYSQQQLAKY WEAFLPEAKA IS
Length:522
Mass (Da):59,070
Last modified:November 16, 2001 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6AC8AA0A589513E3
GO
Isoform 1A (identifier: Q13596-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-155: Missing.

Show »
Length:457
Mass (Da):51,813
Checksum:i3F844B9E84C258C2
GO
Isoform 3 (identifier: Q13596-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-522: LAKYWEAFLPEAKAIS → AGEQLGIRSGILLTKKLPRYSKFFSTVHKFCAAASLWKWGFFLSAYLSYLF

Note: No experimental confirmation available.
Show »
Length:557
Mass (Da):63,082
Checksum:iA03926548995DDA2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YK58H0YK58_HUMAN
Sorting nexin-1
SNX1
128Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKD5H0YKD5_HUMAN
Sorting nexin-1
SNX1
107Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YK42H0YK42_HUMAN
Sorting nexin-1
SNX1
304Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKL5H0YKL5_HUMAN
Sorting nexin-1
SNX1
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KPH4J3KPH4_HUMAN
Sorting nexin-1
SNX1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKT3H0YKT3_HUMAN
Sorting nexin-1
SNX1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YK43H0YK43_HUMAN
Sorting nexin-1
SNX1
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti117P → S in AAC17182 (PubMed:9819414).Curated1
Sequence conflicti211P → S in AAC17182 (PubMed:9819414).Curated1
Sequence conflicti211P → S in AAC17183 (PubMed:9819414).Curated1
Sequence conflicti502Y → C in BAC87312 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052477115S → Y. Corresponds to variant dbSNP:rs1049501Ensembl.1
Natural variantiVAR_034507466D → N. Corresponds to variant dbSNP:rs1802376Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00618991 – 155Missing in isoform 1A. CuratedAdd BLAST65
Alternative sequenceiVSP_044823507 – 522LAKYW…AKAIS → AGEQLGIRSGILLTKKLPRY SKFFSTVHKFCAAASLWKWG FFLSAYLSYLF in isoform 3. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U53225 mRNA Translation: AAA98672.1
AF065483 mRNA Translation: AAC17182.1
AF065484 mRNA Translation: AAC17183.1
BT006983 mRNA Translation: AAP35629.1
AK128179 mRNA Translation: BAC87312.1
AK291752 mRNA Translation: BAF84441.1
AC021541 Genomic DNA No translation available.
AC100840 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77663.1
CH471082 Genomic DNA Translation: EAW77665.1
BC000357 mRNA Translation: AAH00357.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32266.1 [Q13596-1]
CCDS32268.1 [Q13596-2]
CCDS58371.1 [Q13596-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02522

NCBI Reference Sequences

More...
RefSeqi
NP_001229862.1, NM_001242933.1 [Q13596-3]
NP_003090.2, NM_003099.4 [Q13596-1]
NP_683758.1, NM_148955.3 [Q13596-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.188634

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261889; ENSP00000261889; ENSG00000028528 [Q13596-3]
ENST00000559844; ENSP00000453785; ENSG00000028528 [Q13596-1]
ENST00000561026; ENSP00000453567; ENSG00000028528 [Q13596-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6642

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6642

UCSC genome browser

More...
UCSCi
uc002amv.4 human [Q13596-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U53225 mRNA Translation: AAA98672.1
AF065483 mRNA Translation: AAC17182.1
AF065484 mRNA Translation: AAC17183.1
BT006983 mRNA Translation: AAP35629.1
AK128179 mRNA Translation: BAC87312.1
AK291752 mRNA Translation: BAF84441.1
AC021541 Genomic DNA No translation available.
AC100840 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77663.1
CH471082 Genomic DNA Translation: EAW77665.1
BC000357 mRNA Translation: AAH00357.1
CCDSiCCDS32266.1 [Q13596-1]
CCDS32268.1 [Q13596-2]
CCDS58371.1 [Q13596-3]
PIRiG02522
RefSeqiNP_001229862.1, NM_001242933.1 [Q13596-3]
NP_003090.2, NM_003099.4 [Q13596-1]
NP_683758.1, NM_148955.3 [Q13596-2]
UniGeneiHs.188634

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2I4KNMR-A142-269[»]
4FZSX-ray2.80A/B301-522[»]
ProteinModelPortaliQ13596
SMRiQ13596
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112525, 79 interactors
CORUMiQ13596
DIPiDIP-398N
IntActiQ13596, 41 interactors
MINTiQ13596
STRINGi9606.ENSP00000453785

Protein family/group databases

MoonDBiQ13596 Predicted

PTM databases

iPTMnetiQ13596
PhosphoSitePlusiQ13596

Polymorphism and mutation databases

BioMutaiSNX1
DMDMi17380569

Proteomic databases

EPDiQ13596
jPOSTiQ13596
MaxQBiQ13596
PaxDbiQ13596
PeptideAtlasiQ13596
PRIDEiQ13596
ProteomicsDBi59589
59590 [Q13596-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6642
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261889; ENSP00000261889; ENSG00000028528 [Q13596-3]
ENST00000559844; ENSP00000453785; ENSG00000028528 [Q13596-1]
ENST00000561026; ENSP00000453567; ENSG00000028528 [Q13596-2]
GeneIDi6642
KEGGihsa:6642
UCSCiuc002amv.4 human [Q13596-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6642
DisGeNETi6642
EuPathDBiHostDB:ENSG00000028528.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SNX1
HGNCiHGNC:11172 SNX1
HPAiHPA047373
HPA052761
MIMi601272 gene
neXtProtiNX_Q13596
OpenTargetsiENSG00000028528
PharmGKBiPA36011

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2273 Eukaryota
COG5391 LUCA
GeneTreeiENSGT00940000155889
HOGENOMiHOG000293327
HOVERGENiHBG000618
InParanoidiQ13596
KOiK17917
OMAiAHPILQH
OrthoDBi947320at2759
PhylomeDBiQ13596
TreeFamiTF313698

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SNX1 human
EvolutionaryTraceiQ13596

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SNX1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6642

Protein Ontology

More...
PROi
PR:Q13596

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000028528 Expressed in 233 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_SNX1
ExpressionAtlasiQ13596 baseline and differential
GenevisibleiQ13596 HS

Family and domain databases

CDDicd07281 PX_SNX1, 1 hit
Gene3Di1.20.1270.60, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR001683 Phox
IPR036871 PX_dom_sf
IPR034901 PX_SNX1
IPR028660 SNX1
IPR039358 Sorting_nexin-like
IPR005329 Sorting_nexin_N
IPR015404 Vps5_C
PANTHERiPTHR10555 PTHR10555, 1 hit
PTHR10555:SF129 PTHR10555:SF129, 1 hit
PfamiView protein in Pfam
PF00787 PX, 1 hit
PF03700 Sorting_nexin, 1 hit
PF09325 Vps5, 1 hit
SMARTiView protein in SMART
SM00312 PX, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50195 PX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNX1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13596
Secondary accession number(s): A6NM19
, A8K6T7, H0Y2M5, O60750, O60751, Q6ZRJ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 16, 2001
Last modified: January 16, 2019
This is version 180 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again