Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (26 Feb 2020)
Sequence version 2 (03 Apr 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neuronal membrane glycoprotein M6-b

Gene

GPM6B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in neural development. Involved in regulation of osteoblast function and bone formation. Involved in matrix vesicle release by osteoblasts; this function seems to involve maintenance of the actin cytoskeleton. May be involved in cellular trafficking of SERT and thereby in regulation of serotonin uptake.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis, Osteogenesis, Protein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuronal membrane glycoprotein M6-b
Short name:
M6b
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPM6B
Synonyms:M6B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4461 GPM6B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300051 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13491

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei31 – 51HelicalSequence analysisAdd BLAST21
Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Transmembranei136 – 156HelicalSequence analysisAdd BLAST21
Transmembranei224 – 244HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
2824

Open Targets

More...
OpenTargetsi
ENSG00000046653

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28844

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q13491 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GPM6B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20141466

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001590211 – 265Neuronal membrane glycoprotein M6-bAdd BLAST265

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi73N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi177N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei257PhosphoserineBy similarity1
Isoform 4 (identifier: Q13491-4)
Modified residuei318PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13491

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q13491

PeptideAtlas

More...
PeptideAtlasi
Q13491

PRoteomics IDEntifications database

More...
PRIDEi
Q13491

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
59485 [Q13491-1]
59486 [Q13491-2]
59487 [Q13491-3]
59488 [Q13491-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13491

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13491

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Neurons and glia; cerebellar Bergmann glia, in glia within white matter tracts of the cerebellum and cerebrum, and in embryonic dorsal root ganglia.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000046653 Expressed in globus pallidus and 233 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13491 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13491 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA002913

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SERT.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109085, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q13491, 5 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q13491 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13491

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the myelin proteolipid protein family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006915

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13491

Identification of Orthologs from Complete Genome Data

More...
OMAi
MMDQVFH

Database of Orthologous Groups

More...
OrthoDBi
914457at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13491

TreeFam database of animal gene trees

More...
TreeFami
TF315162

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001614 Myelin_PLP
IPR018237 Myelin_PLP_CS

The PANTHER Classification System

More...
PANTHERi
PTHR11683 PTHR11683, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01275 Myelin_PLP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00214 MYELINPLP

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00002 PLP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00575 MYELIN_PLP_1, 1 hit
PS01004 MYELIN_PLP_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13491-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKPAMETAAE ENTEQSQERK GCFECCIKCL GGVPYASLVA TILCFSGVAL
60 70 80 90 100
FCGCGHVALA GTVAILEQHF STNASDHALL SEVIQLMQYV IYGIASFFFL
110 120 130 140 150
YGIILLAEGF YTTSAVKELH GEFKTTACGR CISGMFVFLT YVLGVAWLGV
160 170 180 190 200
FGFSAVPVFM FYNIWSTCEV IKSPQTNGTT GVEQICVDIR QYGIIPWNAF
210 220 230 240 250
PGKICGSALE NICNTNEFYM SYHLFIVACA GAGATVIALL IYMMATTYNY
260
AVLKFKSRED CCTKF
Length:265
Mass (Da):28,989
Last modified:April 3, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i560AB12DD2B5AE75
GO
Isoform 2 (identifier: Q13491-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MKPAMETAAEENTEQSQERK → M

Show »
Length:246
Mass (Da):26,830
Checksum:i9DA14EFDF2CFB81F
GO
Isoform 3 (identifier: Q13491-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-20: K → KVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP

Show »
Length:305
Mass (Da):33,538
Checksum:i69BE0DAA9B35C3A0
GO
Isoform 4 (identifier: Q13491-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-20: K → KVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP
     240-265: LIYMMATTYNYAVLKFKSREDCCTKF → IHFLMILSSNWAYLKDASKMQAYQDIKAKEEQELQDIQSRSKEQLNSYT

Show »
Length:328
Mass (Da):36,220
Checksum:i58E2FC71DEA76C7A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z613B7Z613_HUMAN
Neuronal membrane glycoprotein M6-b
GPM6B
302Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z248B7Z248_HUMAN
Neuronal membrane glycoprotein M6-b
GPM6B
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J028C9J028_HUMAN
Neuronal membrane glycoprotein M6-b
GPM6B
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZE8C9JZE8_HUMAN
Neuronal membrane glycoprotein M6-b
GPM6B
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8H8C9J8H8_HUMAN
Neuronal membrane glycoprotein M6-b
GPM6B
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB16888 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAC19165 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0033261 – 20MKPAM…SQERK → M in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_04112120K → KVNSRAEMEIGRYHWMYPGS KNHQYHPVPTLGDRASPLSS P in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_043247240 – 265LIYMM…CCTKF → IHFLMILSSNWAYLKDASKM QAYQDIKAKEEQELQDIQSR SKEQLNSYT in isoform 4. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U45955 mRNA Translation: AAB16888.1 Different initiation.
AF037347 AF037346 Genomic DNA Translation: AAC19165.1 Different initiation.
AF037347 AF037346 Genomic DNA Translation: AAC19166.1
AF016004 mRNA Translation: AAC28560.1
AF047197 AF047196 Genomic DNA Translation: AAD13718.1
AK095657 mRNA Translation: BAC04600.1
AC003035 Genomic DNA No translation available.
AC003037 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98845.1
CH471074 Genomic DNA Translation: EAW98846.1
BC008151 mRNA Translation: AAH08151.1
BC047295 mRNA Translation: AAH47295.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14158.1 [Q13491-1]
CCDS35206.1 [Q13491-4]
CCDS35207.1 [Q13491-3]
CCDS48084.1 [Q13491-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001001994.1, NM_001001994.2 [Q13491-2]
NP_001001995.1, NM_001001995.2 [Q13491-4]
NP_001001996.1, NM_001001996.2 [Q13491-3]
NP_005269.1, NM_005278.4 [Q13491-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000316715; ENSP00000316861; ENSG00000046653 [Q13491-4]
ENST00000355135; ENSP00000347258; ENSG00000046653 [Q13491-3]
ENST00000356942; ENSP00000349420; ENSG00000046653 [Q13491-1]
ENST00000454189; ENSP00000389915; ENSG00000046653 [Q13491-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2824

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2824

UCSC genome browser

More...
UCSCi
uc004cvw.4 human [Q13491-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U45955 mRNA Translation: AAB16888.1 Different initiation.
AF037347 AF037346 Genomic DNA Translation: AAC19165.1 Different initiation.
AF037347 AF037346 Genomic DNA Translation: AAC19166.1
AF016004 mRNA Translation: AAC28560.1
AF047197 AF047196 Genomic DNA Translation: AAD13718.1
AK095657 mRNA Translation: BAC04600.1
AC003035 Genomic DNA No translation available.
AC003037 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98845.1
CH471074 Genomic DNA Translation: EAW98846.1
BC008151 mRNA Translation: AAH08151.1
BC047295 mRNA Translation: AAH47295.1
CCDSiCCDS14158.1 [Q13491-1]
CCDS35206.1 [Q13491-4]
CCDS35207.1 [Q13491-3]
CCDS48084.1 [Q13491-2]
RefSeqiNP_001001994.1, NM_001001994.2 [Q13491-2]
NP_001001995.1, NM_001001995.2 [Q13491-4]
NP_001001996.1, NM_001001996.2 [Q13491-3]
NP_005269.1, NM_005278.4 [Q13491-1]

3D structure databases

SMRiQ13491
ModBaseiSearch...

Protein-protein interaction databases

BioGridi109085, 13 interactors
IntActiQ13491, 5 interactors

PTM databases

iPTMnetiQ13491
PhosphoSitePlusiQ13491

Polymorphism and mutation databases

BioMutaiGPM6B
DMDMi20141466

Proteomic databases

jPOSTiQ13491
MassIVEiQ13491
PeptideAtlasiQ13491
PRIDEiQ13491
ProteomicsDBi59485 [Q13491-1]
59486 [Q13491-2]
59487 [Q13491-3]
59488 [Q13491-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2824

Genome annotation databases

EnsembliENST00000316715; ENSP00000316861; ENSG00000046653 [Q13491-4]
ENST00000355135; ENSP00000347258; ENSG00000046653 [Q13491-3]
ENST00000356942; ENSP00000349420; ENSG00000046653 [Q13491-1]
ENST00000454189; ENSP00000389915; ENSG00000046653 [Q13491-2]
GeneIDi2824
KEGGihsa:2824
UCSCiuc004cvw.4 human [Q13491-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2824
DisGeNETi2824

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GPM6B
HGNCiHGNC:4461 GPM6B
HPAiHPA002913
MIMi300051 gene
neXtProtiNX_Q13491
OpenTargetsiENSG00000046653
PharmGKBiPA28844

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000006915
InParanoidiQ13491
OMAiMMDQVFH
OrthoDBi914457at2759
PhylomeDBiQ13491
TreeFamiTF315162

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GPM6B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GPM6B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2824
PharosiQ13491 Tbio

Protein Ontology

More...
PROi
PR:Q13491
RNActiQ13491 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000046653 Expressed in globus pallidus and 233 other tissues
ExpressionAtlasiQ13491 baseline and differential
GenevisibleiQ13491 HS

Family and domain databases

InterProiView protein in InterPro
IPR001614 Myelin_PLP
IPR018237 Myelin_PLP_CS
PANTHERiPTHR11683 PTHR11683, 1 hit
PfamiView protein in Pfam
PF01275 Myelin_PLP, 1 hit
PRINTSiPR00214 MYELINPLP
SMARTiView protein in SMART
SM00002 PLP, 1 hit
PROSITEiView protein in PROSITE
PS00575 MYELIN_PLP_1, 1 hit
PS01004 MYELIN_PLP_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGPM6B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13491
Secondary accession number(s): O76077, Q86X43, Q8N956
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 3, 2002
Last modified: February 26, 2020
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again