Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 218 (13 Nov 2019)
Sequence version 2 (05 Jul 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear factor of activated T-cells, cytoplasmic 2

Gene

NFATC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. Promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi421 – 4288

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2025928 Calcineurin activates NFAT
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-5607763 CLEC7A (Dectin-1) induces NFAT activation
R-HSA-8877330 RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13469

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 2
Short name:
NF-ATc2
Short name:
NFATc2
Alternative name(s):
NFAT pre-existing subunit
Short name:
NF-ATp
T-cell transcription factor NFAT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NFATC2
Synonyms:NFAT1, NFATP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7776 NFATC2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600490 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13469

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4773

Open Targets

More...
OpenTargetsi
ENSG00000101096

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31583

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q13469

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NFATC2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68846905

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002051781 – 925Nuclear factor of activated T-cells, cytoplasmic 2Add BLAST925

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei23PhosphoserineCombined sources1
Modified residuei99PhosphoserineBy similarity1
Modified residuei107PhosphoserineCombined sources1
Modified residuei110PhosphoserineCombined sources1
Modified residuei148PhosphoserineCombined sources1
Modified residuei168PhosphoserineBy similarity1
Modified residuei171PhosphoserineBy similarity1
Modified residuei172PhosphoserineBy similarity1
Modified residuei174PhosphoserineBy similarity1
Modified residuei175PhosphoserineBy similarity1
Modified residuei177PhosphoserineBy similarity1
Modified residuei180PhosphoserineBy similarity1
Modified residuei213PhosphoserineBy similarity1
Modified residuei217PhosphoserineBy similarity1
Modified residuei221PhosphoserineBy similarity1
Modified residuei236PhosphoserineBy similarity1
Modified residuei243PhosphoserineBy similarity1
Modified residuei255PhosphoserineBy similarity1
Modified residuei268PhosphoserineBy similarity1
Modified residuei274PhosphoserineBy similarity1
Modified residuei276PhosphoserineBy similarity1
Modified residuei280PhosphoserineBy similarity1
Modified residuei326PhosphoserineCombined sources1
Modified residuei330PhosphoserineCombined sources1
Modified residuei363PhosphoserineBy similarity1
Modified residuei755PhosphoserineCombined sources1
Modified residuei757PhosphoserineCombined sources1
Modified residuei759PhosphoserineCombined sources1
Modified residuei856PhosphoserineCombined sources1
Modified residuei859PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

In resting cells, phosphorylated by NFATC-kinase on at least 18 sites in the 99-363 region. Upon cell stimulation, all these sites except Ser-243 are dephosphorylated by calcineurin. Dephosphorylation induces a conformational change that simultaneously exposes an NLS and masks an NES, which results in nuclear localization. Simultaneously, Ser-53 or Ser-56 is phosphorylated; which is required for full transcriptional activity.By similarity
Ubiquitinated in endothelial cells by RNF213 downstream of the non-canonical Wnt signaling pathway, leading to its degradation by the proteasome.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13469

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13469

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q13469

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13469

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13469

PeptideAtlas

More...
PeptideAtlasi
Q13469

PRoteomics IDEntifications database

More...
PRIDEi
Q13469

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
59464 [Q13469-1]
59465 [Q13469-2]
59466 [Q13469-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13469

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13469

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Isoform 1 is highly expressed in the small intestine, heart, testis, prostate, thymus, placenta and thyroid. Isoform 3 is highly expressed in stomach, uterus, placenta, trachea and thyroid.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Inducibly expressed in T-lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101096 Expressed in 189 organ(s), highest expression level in thoracic mammary gland

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13469 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018567
HPA008789
HPA024369

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. The phosphorylated form specifically interacts with XPO1; which mediates nuclear export. NFATC proteins bind to DNA as monomers.

Interacts with NFATC2IP (By similarity).

Interacts with FOXP3 (PubMed:15790681).

Interacts with TBX21 ('Thr-303' phosphorylated form) (By similarity).

Interacts with KAT2A (By similarity).

Interacts with HOMER2 and HOMER3; this interaction competes with calcineurin/PPP3CA-binding and hence prevents NFATC2 dephosphorylation and activation (PubMed:18218901).

Interacts with protein phosphatase PPP3CA/calcineurin A (PubMed:26248042).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110846, 186 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-480 AP-1 transcription factor complex FOS-JUN-NFATC2

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q13469

Database of interacting proteins

More...
DIPi
DIP-27630N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q13469

Protein interaction database and analysis system

More...
IntActi
Q13469, 17 interactors

Molecular INTeraction database

More...
MINTi
Q13469

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000379330

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1925
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13469

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q13469

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati184 – 2001Add BLAST17
Repeati213 – 2292Add BLAST17
Repeati272 – 2863; approximateAdd BLAST15
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini392 – 574RHDPROSITE-ProRule annotationAdd BLAST183

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni111 – 116Calcineurin-binding1 Publication6
Regioni119 – 199Trans-activation domain A (TAD-A)Add BLAST81
Regioni161 – 175Required for cytoplasmic retention of the phosphorylated formBy similarityAdd BLAST15
Regioni184 – 2863 X approximate SP repeatsAdd BLAST103

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi26 – 349aaTAD9
Motifi251 – 253Nuclear localization signal3
Motifi664 – 666Nuclear localization signal3
Motifi904 – 913Nuclear export signal10

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication
Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHFR Eukaryota
ENOG41105U2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156230

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231780

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13469

KEGG Orthology (KO)

More...
KOi
K17332

Identification of Orthologs from Complete Genome Data

More...
OMAi
KNSIPCH

Database of Orthologous Groups

More...
OrthoDBi
277998at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13469

TreeFam database of animal gene trees

More...
TreeFami
TF326480

Family and domain databases

Database of protein disorder

More...
DisProti
DP01344

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit
2.60.40.340, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR008366 NFAT
IPR008967 p53-like_TF_DNA-bd
IPR032397 RHD_dimer
IPR011539 RHD_DNA_bind_dom
IPR037059 RHD_DNA_bind_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12533 PTHR12533, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16179 RHD_dimer, 1 hit
PF00554 RHD_DNA_bind, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01789 NUCFACTORATC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429 IPT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49417 SSF49417, 1 hit
SSF81296 SSF81296, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50254 REL_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q13469-1) [UniParc]FASTAAdd to basket
Also known as: C, NFATc2_IB_IIL

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNAPERQPQP DGGDAPGHEP GGSPQDELDF SILFDYEYLN PNEEEPNAHK
60 70 80 90 100
VASPPSGPAY PDDVLDYGLK PYSPLASLSG EPPGRFGEPD RVGPQKFLSA
110 120 130 140 150
AKPAGASGLS PRIEITPSHE LIQAVGPLRM RDAGLLVEQP PLAGVAASPR
160 170 180 190 200
FTLPVPGFEG YREPLCLSPA SSGSSASFIS DTFSPYTSPC VSPNNGGPDD
210 220 230 240 250
LCPQFQNIPA HYSPRTSPIM SPRTSLAEDS CLGRHSPVPR PASRSSSPGA
260 270 280 290 300
KRRHSCAEAL VALPPGASPQ RSRSPSPQPS SHVAPQDHGS PAGYPPVAGS
310 320 330 340 350
AVIMDALNSL ATDSPCGIPP KMWKTSPDPS PVSAAPSKAG LPRHIYPAVE
360 370 380 390 400
FLGPCEQGER RNSAPESILL VPPTWPKPLV PAIPICSIPV TASLPPLEWP
410 420 430 440 450
LSSQSGSYEL RIEVQPKPHH RAHYETEGSR GAVKAPTGGH PVVQLHGYME
460 470 480 490 500
NKPLGLQIFI GTADERILKP HAFYQVHRIT GKTVTTTSYE KIVGNTKVLE
510 520 530 540 550
IPLEPKNNMR ATIDCAGILK LRNADIELRK GETDIGRKNT RVRLVFRVHI
560 570 580 590 600
PESSGRIVSL QTASNPIECS QRSAHELPMV ERQDTDSCLV YGGQQMILTG
610 620 630 640 650
QNFTSESKVV FTEKTTDGQQ IWEMEATVDK DKSQPNMLFV EIPEYRNKHI
660 670 680 690 700
RTPVKVNFYV INGKRKRSQP QHFTYHPVPA IKTEPTDEYD PTLICSPTHG
710 720 730 740 750
GLGSQPYYPQ HPMVAESPSC LVATMAPCQQ FRTGLSSPDA RYQQQNPAAV
760 770 780 790 800
LYQRSKSLSP SLLGYQQPAL MAAPLSLADA HRSVLVHAGS QGQSSALLHP
810 820 830 840 850
SPTNQQASPV IHYSPTNQQL RCGSHQEFQH IMYCENFAPG TTRPGPPPVS
860 870 880 890 900
QGQRLSPGSY PTVIQQQNAT SQRAAKNGPP VSDQKEVLPA GVTIKQEQNL
910 920
DQTYLDDVNE IIRKEFSGPP ARNQT
Length:925
Mass (Da):100,146
Last modified:July 5, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8DAE86855CCB58D3
GO
Isoform 2 (identifier: Q13469-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL

Show »
Length:921
Mass (Da):99,784
Checksum:i71C45C9B348AE9C8
GO
Isoform 3 (identifier: Q13469-3) [UniParc]FASTAAdd to basket
Also known as: NFATc2_IA_IIL

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNE → MQREAAFRLGHCHPLRIMGSVDQ
     908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL

Show »
Length:901
Mass (Da):97,693
Checksum:i158B2F7F9966CCBA
GO
Isoform 4 (identifier: Q13469-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNE → MQREAAFRLGHCHPLRIMGSVDQ

Show »
Length:905
Mass (Da):98,054
Checksum:i69D7F7B758842B37
GO
Isoform 5 (identifier: Q13469-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL

Note: No experimental confirmation available.
Show »
Length:702
Mass (Da):76,700
Checksum:iD3CA427C994A5605
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti65L → M in AAC50886 (PubMed:8668213).Curated1
Sequence conflicti65L → M in AAC50887 (PubMed:8668213).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051783446H → R. Corresponds to variant dbSNP:rs12479626Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0559261 – 219Missing in isoform 5. 1 PublicationAdd BLAST219
Alternative sequenceiVSP_0427571 – 43MNAPE…LNPNE → MQREAAFRLGHCHPLRIMGS VDQ in isoform 3 and isoform 4. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_005595908 – 925VNEII…ARNQT → ELIDTHLSWIQNIL in isoform 2, isoform 3 and isoform 5. 3 PublicationsAdd BLAST18

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U43341 mRNA Translation: AAC50886.1
U43342 mRNA Translation: AAC50887.1
EU887573 mRNA Translation: ACG55593.1
EU887574 mRNA Translation: ACG55594.1
EU887575 mRNA Translation: ACG55595.1
EU887576 mRNA Translation: ACG55596.1
EU887577 mRNA Translation: ACG55597.1
EU887578 mRNA Translation: ACG55598.1
AL132866 Genomic DNA No translation available.
AL035682 Genomic DNA No translation available.
AL035684 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75602.1
CH471077 Genomic DNA Translation: EAW75603.1
BC136418 mRNA Translation: AAI36419.1
BC144074 mRNA Translation: AAI44075.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13437.1 [Q13469-1]
CCDS33488.1 [Q13469-2]
CCDS46614.1 [Q13469-3]
CCDS68156.1 [Q13469-5]
CCDS68157.1 [Q13469-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02326

NCBI Reference Sequences

More...
RefSeqi
NP_001129493.1, NM_001136021.2 [Q13469-3]
NP_001245221.1, NM_001258292.1 [Q13469-4]
NP_001245223.1, NM_001258294.1 [Q13469-5]
NP_001245225.1, NM_001258296.1 [Q13469-5]
NP_036472.2, NM_012340.4 [Q13469-2]
NP_775114.1, NM_173091.3 [Q13469-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371564; ENSP00000360619; ENSG00000101096 [Q13469-2]
ENST00000396009; ENSP00000379330; ENSG00000101096 [Q13469-1]
ENST00000414705; ENSP00000396471; ENSG00000101096 [Q13469-3]
ENST00000609507; ENSP00000477342; ENSG00000101096 [Q13469-5]
ENST00000609943; ENSP00000477370; ENSG00000101096 [Q13469-4]
ENST00000610033; ENSP00000477142; ENSG00000101096 [Q13469-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4773

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4773

UCSC genome browser

More...
UCSCi
uc002xwc.4 human [Q13469-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U43341 mRNA Translation: AAC50886.1
U43342 mRNA Translation: AAC50887.1
EU887573 mRNA Translation: ACG55593.1
EU887574 mRNA Translation: ACG55594.1
EU887575 mRNA Translation: ACG55595.1
EU887576 mRNA Translation: ACG55596.1
EU887577 mRNA Translation: ACG55597.1
EU887578 mRNA Translation: ACG55598.1
AL132866 Genomic DNA No translation available.
AL035682 Genomic DNA No translation available.
AL035684 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75602.1
CH471077 Genomic DNA Translation: EAW75603.1
BC136418 mRNA Translation: AAI36419.1
BC144074 mRNA Translation: AAI44075.1
CCDSiCCDS13437.1 [Q13469-1]
CCDS33488.1 [Q13469-2]
CCDS46614.1 [Q13469-3]
CCDS68156.1 [Q13469-5]
CCDS68157.1 [Q13469-4]
PIRiG02326
RefSeqiNP_001129493.1, NM_001136021.2 [Q13469-3]
NP_001245221.1, NM_001258292.1 [Q13469-4]
NP_001245223.1, NM_001258294.1 [Q13469-5]
NP_001245225.1, NM_001258296.1 [Q13469-5]
NP_036472.2, NM_012340.4 [Q13469-2]
NP_775114.1, NM_173091.3 [Q13469-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A02X-ray2.70N392-678[»]
1OWRX-ray3.00M/N/P/Q396-678[»]
1P7HX-ray2.60L/M/N/O393-678[»]
1PZUX-ray3.10B/D/H/I/L/M396-678[»]
1S9KX-ray3.10C399-678[»]
2AS5X-ray2.70M/N392-678[»]
2O93X-ray3.05L/M/O396-678[»]
3QRFX-ray2.80M/N396-678[»]
SMRiQ13469
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi110846, 186 interactors
ComplexPortaliCPX-480 AP-1 transcription factor complex FOS-JUN-NFATC2
CORUMiQ13469
DIPiDIP-27630N
ELMiQ13469
IntActiQ13469, 17 interactors
MINTiQ13469
STRINGi9606.ENSP00000379330

PTM databases

iPTMnetiQ13469
PhosphoSitePlusiQ13469

Polymorphism and mutation databases

BioMutaiNFATC2
DMDMi68846905

Proteomic databases

EPDiQ13469
jPOSTiQ13469
MassIVEiQ13469
MaxQBiQ13469
PaxDbiQ13469
PeptideAtlasiQ13469
PRIDEiQ13469
ProteomicsDBi59464 [Q13469-1]
59465 [Q13469-2]
59466 [Q13469-3]

Genome annotation databases

EnsembliENST00000371564; ENSP00000360619; ENSG00000101096 [Q13469-2]
ENST00000396009; ENSP00000379330; ENSG00000101096 [Q13469-1]
ENST00000414705; ENSP00000396471; ENSG00000101096 [Q13469-3]
ENST00000609507; ENSP00000477342; ENSG00000101096 [Q13469-5]
ENST00000609943; ENSP00000477370; ENSG00000101096 [Q13469-4]
ENST00000610033; ENSP00000477142; ENSG00000101096 [Q13469-5]
GeneIDi4773
KEGGihsa:4773
UCSCiuc002xwc.4 human [Q13469-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4773
DisGeNETi4773

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NFATC2
HGNCiHGNC:7776 NFATC2
HPAiCAB018567
HPA008789
HPA024369
MIMi600490 gene
neXtProtiNX_Q13469
OpenTargetsiENSG00000101096
PharmGKBiPA31583

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHFR Eukaryota
ENOG41105U2 LUCA
GeneTreeiENSGT00940000156230
HOGENOMiHOG000231780
InParanoidiQ13469
KOiK17332
OMAiKNSIPCH
OrthoDBi277998at2759
PhylomeDBiQ13469
TreeFamiTF326480

Enzyme and pathway databases

ReactomeiR-HSA-2025928 Calcineurin activates NFAT
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-5607763 CLEC7A (Dectin-1) induces NFAT activation
R-HSA-8877330 RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
SIGNORiQ13469

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NFATC2 human
EvolutionaryTraceiQ13469

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NFATC2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4773
PharosiQ13469

Protein Ontology

More...
PROi
PR:Q13469

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101096 Expressed in 189 organ(s), highest expression level in thoracic mammary gland
GenevisibleiQ13469 HS

Family and domain databases

DisProtiDP01344
Gene3Di2.60.40.10, 1 hit
2.60.40.340, 1 hit
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR008366 NFAT
IPR008967 p53-like_TF_DNA-bd
IPR032397 RHD_dimer
IPR011539 RHD_DNA_bind_dom
IPR037059 RHD_DNA_bind_dom_sf
PANTHERiPTHR12533 PTHR12533, 1 hit
PfamiView protein in Pfam
PF16179 RHD_dimer, 1 hit
PF00554 RHD_DNA_bind, 1 hit
PRINTSiPR01789 NUCFACTORATC
SMARTiView protein in SMART
SM00429 IPT, 1 hit
SUPFAMiSSF49417 SSF49417, 1 hit
SSF81296 SSF81296, 1 hit
PROSITEiView protein in PROSITE
PS50254 REL_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFAC2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13469
Secondary accession number(s): B5B2N8
, B5B2N9, B5B2P0, B5B2P2, B5B2P3, Q13468, Q5TFW7, Q5TFW8, Q9NPX6, Q9NQH3, Q9UJR2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 5, 2005
Last modified: November 13, 2019
This is version 218 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again