UniProtKB - Q13405 (RM49_HUMAN)

BLAST

>sp|Q13405|RM49_HUMAN 39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1
MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDP
PKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWAL
QKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF

Align
Format
Add to basket Added to basket
History
Entry version 150 (07 Nov 2018)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

39S ribosomal protein L49, mitochondrial

Gene

MRPL49

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Molecular functionⁱ

structural constituent of ribosome
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

mitochondrial translational elongation Source: Reactome
mitochondrial translational termination Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein

Molecular function

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

Reactomeⁱ	R-HSA-5368286 Mitochondrial translation initiation R-HSA-5389840 Mitochondrial translation elongation R-HSA-5419276 Mitochondrial translation termination

Reactomeⁱ

R-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 39S ribosomal protein L49, mitochondrial Short name: L49mt Short name: MRP-L49 Alternative name(s): Mitochondrial large ribosomal subunit protein mL491 Publication Neighbor of FAU Short name: NOF Protein NOF1
Gene namesⁱ	Name:MRPL49 Synonyms:C11orf4, NOF1 ORF Names:OK/SW-cl.67
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 11

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000149792.8
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:1176 MRPL49
MIMⁱ	606866 gene
neXtProtⁱ	NX_Q13405

Keywords - Cellular componentⁱ

Mitochondrion

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	740
Open Targets More...OpenTargetsⁱ	ENSG00000149792
PharmGKBⁱ	PA30981

Polymorphism and mutation databases

BioMutaⁱ	MRPL49

BioMutaⁱ

MRPL49

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000207664	1 – 166	39S ribosomal protein L49, mitochondrialAdd BLAST		166

Proteomic databases

EPDⁱ	Q13405
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q13405
PaxDbⁱ	Q13405
PeptideAtlas More...PeptideAtlasⁱ	Q13405
PRIDEⁱ	Q13405
ProteomicsDBⁱ	59387
TopDownProteomicsⁱ	Q13405

PTM databases

iPTMnetⁱ	Q13405
PhosphoSitePlusⁱ	Q13405

Expressionⁱ

Tissue specificityⁱ

Ubiquitous.

Gene expression databases

Bgeeⁱ	ENSG00000149792 Expressed in 232 organ(s), highest expression level in right adrenal gland
CleanExⁱ	HS_MRPL49
ExpressionAtlasⁱ	Q13405 baseline and differential
Genevisibleⁱ	Q13405 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA046778

HPAⁱ

HPA046778

Interactionⁱ

Subunit structureⁱ

Component of the mitochondrial large ribosomal subunit (mt-LSU) (PubMed:28892042, PubMed:25838379, PubMed:25278503). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins (PubMed:11551941, PubMed:25278503, PubMed:25838379). Interacts with OXA1L (By similarity).By similarity4 Publications

Protein-protein interaction databases

BioGridⁱ	107199, 56 interactors
CORUMⁱ	Q13405
IntActⁱ	Q13405, 19 interactors
Molecular INTeraction database More...MINTⁱ	Q13405
STRINGⁱ	9606.ENSP00000279242

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	39 – 42	Combined sources	4
Helixⁱ	46 – 49	Combined sources	4
Beta strandⁱ	64 – 67	Combined sources	4
Turnⁱ	69 – 71	Combined sources	3
Beta strandⁱ	83 – 86	Combined sources	4
Beta strandⁱ	96 – 101	Combined sources	6
Turnⁱ	102 – 104	Combined sources	3
Beta strandⁱ	105 – 110	Combined sources	6
Beta strandⁱ	113 – 115	Combined sources	3
Helixⁱ	117 – 128	Combined sources	12
Helixⁱ	129 – 131	Combined sources	3
Beta strandⁱ	138 – 141	Combined sources	4
Turnⁱ	142 – 145	Combined sources	4
Beta strandⁱ	146 – 151	Combined sources	6
Helixⁱ	154 – 164	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	Q13405
SMRⁱ	Q13405
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the mitochondrion-specific ribosomal protein mL49 family.Curated

Phylogenomic databases

eggNOGⁱ	KOG4034 Eukaryota ENOG4111N34 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000017253
HOGENOMⁱ	HOG000044600
HOVERGENⁱ	HBG023124
InParanoidⁱ	Q13405
KEGG Orthology (KO) More...KOⁱ	K17430
OMAⁱ	YPSGWKP
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G1549
PhylomeDBⁱ	Q13405
TreeFamⁱ	TF317750

Family and domain databases

InterProⁱ	View protein in InterPro IPR007740 Ribosomal_L49/IMG2
PANTHERⁱ	PTHR13477 PTHR13477, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF05046 Img2, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 4 potential isoforms that are computationally mapped.Show all Align All

Q13405-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAATMFRATL RGWRTGVQRG CGLRLLSQTQ GPPDYPRFVE SVDEYQFVER 
        60         70         80         90        100
LLPATRIPDP PKHEHYPTPS GWQPPRDPPP NLPYFVRRSR MHNIPVYKDI 
       110        120        130        140        150
THGNRQMTVI RKVEGDIWAL QKDVEDFLSP LLGKTPVTQV NEVTGTLRIK 
       160 
GYFDQELKAW LLEKGF

Length:166

Mass (Da):19,198

Last modified:November 1, 1996 - v1

Checksum:ⁱ66AB18FDE25D92B4

Computationally mapped potential isoform sequencesⁱ

There are 4 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

E9PNF1	E9PNF1_HUMAN	39S ribosomal protein L49, mitochon... 39S ribosomal protein L49, mitochondrial	MRPL49	140	Annotation score:
H0YDP7	H0YDP7_HUMAN	39S ribosomal protein L49, mitochon... 39S ribosomal protein L49, mitochondrial	MRPL49	127	Annotation score:
E9PI78	E9PI78_HUMAN	39S ribosomal protein L49, mitochon... 39S ribosomal protein L49, mitochondrial	MRPL49	99	Annotation score:
E9PRD2	E9PRD2_HUMAN	39S ribosomal protein L49, mitochon... 39S ribosomal protein L49, mitochondrial	MRPL49	56	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_021991	9	T → A. Corresponds to variant dbSNP:rs17146691Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U39400 mRNA Translation: AAB18826.1 AB062395 mRNA Translation: BAB93482.1 AK311821 mRNA Translation: BAG34763.1 CH471076 Genomic DNA Translation: EAW74355.1 BC004378 mRNA Translation: AAH04378.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS8096.1
PIRⁱ	G02237
NCBI Reference Sequences More...RefSeqⁱ	NP_004918.1, NM_004927.3
UniGeneⁱ	Hs.744882

Genome annotation databases

Ensemblⁱ	ENST00000279242; ENSP00000279242; ENSG00000149792 ENST00000526319; ENSP00000434190; ENSG00000149792
GeneIDⁱ	740
KEGGⁱ	hsa:740
UCSC genome browser More...UCSCⁱ	uc001oda.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q13405	Mitochondrial ribosomal protein L49, isoform CRA_b		HUMAN		166	UniRef100_Q13405

Protein	Similar proteins		Species	Score	Length	Source
Q13405	39S ribosomal protein L49, mitochondrial		PONAB		166	UniRef90_Q13405
39S ribosomal protein L49, mitochondrial		BOVIN		166
Mitochondrial ribosomal protein L49, isoform CRA_b		HUMAN		166
Uncharacterized protein		SHEEP		168
Uncharacterized protein		CHLSB		167
+50

Protein	Similar proteins		Species	Score	Length	Source
Q13405	39S ribosomal protein L49, mitochondrial		PONAB		166	UniRef50_Q13405
39S ribosomal protein L49, mitochondrial		BOVIN		166
39S ribosomal protein L49, mitochondrial		MOUSE		166
39S ribosomal protein L49, mitochondrial		MACFA		166
Mitochondrial ribosomal protein L49, isoform CRA_b		HUMAN		166
+214

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U39400 mRNA Translation: AAB18826.1 AB062395 mRNA Translation: BAB93482.1 AK311821 mRNA Translation: BAG34763.1 CH471076 Genomic DNA Translation: EAW74355.1 BC004378 mRNA Translation: AAH04378.1
CCDSⁱ	CCDS8096.1
PIRⁱ	G02237
RefSeqⁱ	NP_004918.1, NM_004927.3
UniGeneⁱ	Hs.744882

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3J7Y	electron microscopy	3.40	g	1-166	[»]
	3J9M	electron microscopy	3.50	g	1-166	[»]
	5OOL	electron microscopy	3.06	g	1-166	[»]
	5OOM	electron microscopy	3.03	g	1-166	[»]
ProteinModelPortalⁱ	Q13405
SMRⁱ	Q13405
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	107199, 56 interactors
CORUMⁱ	Q13405
IntActⁱ	Q13405, 19 interactors
MINTⁱ	Q13405
STRINGⁱ	9606.ENSP00000279242

PTM databases

iPTMnetⁱ	Q13405
PhosphoSitePlusⁱ	Q13405

Polymorphism and mutation databases

BioMutaⁱ	MRPL49

BioMutaⁱ

MRPL49

Proteomic databases

EPDⁱ	Q13405
MaxQBⁱ	Q13405
PaxDbⁱ	Q13405
PeptideAtlasⁱ	Q13405
PRIDEⁱ	Q13405
ProteomicsDBⁱ	59387
TopDownProteomicsⁱ	Q13405

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000279242; ENSP00000279242; ENSG00000149792 ENST00000526319; ENSP00000434190; ENSG00000149792
GeneIDⁱ	740
KEGGⁱ	hsa:740
UCSCⁱ	uc001oda.3 human

Organism-specific databases

CTDⁱ	740
DisGeNETⁱ	740
EuPathDBⁱ	HostDB:ENSG00000149792.8
GeneCardsⁱ	MRPL49
HGNCⁱ	HGNC:1176 MRPL49
HPAⁱ	HPA046778
MIMⁱ	606866 gene
neXtProtⁱ	NX_Q13405
OpenTargetsⁱ	ENSG00000149792
PharmGKBⁱ	PA30981
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG4034 Eukaryota ENOG4111N34 LUCA
GeneTreeⁱ	ENSGT00390000017253
HOGENOMⁱ	HOG000044600
HOVERGENⁱ	HBG023124
InParanoidⁱ	Q13405
KOⁱ	K17430
OMAⁱ	YPSGWKP
OrthoDBⁱ	EOG091G1549
PhylomeDBⁱ	Q13405
TreeFamⁱ	TF317750

Enzyme and pathway databases

Reactomeⁱ	R-HSA-5368286 Mitochondrial translation initiation R-HSA-5389840 Mitochondrial translation elongation R-HSA-5419276 Mitochondrial translation termination

Reactomeⁱ

R-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Miscellaneous databases

ChiTaRSⁱ	MRPL49 human
GenomeRNAiⁱ	740
Protein Ontology More...PROⁱ	PR:Q13405
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000149792 Expressed in 232 organ(s), highest expression level in right adrenal gland
CleanExⁱ	HS_MRPL49
ExpressionAtlasⁱ	Q13405 baseline and differential
Genevisibleⁱ	Q13405 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR007740 Ribosomal_L49/IMG2
PANTHERⁱ	PTHR13477 PTHR13477, 1 hit
Pfamⁱ	View protein in Pfam PF05046 Img2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RM49_HUMAN
Accessionⁱ	Q13405Primary (citable) accession number: Q13405 Secondary accession number(s): B2R4G6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 15, 1999
	Last sequence update:	November 1, 1996
	Last modified:	November 7, 2018
	This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Ribosomal proteins
Ribosomal proteins families and list of entries
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 11
Human chromosome 11: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q13405 (RM49_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

39S ribosomal protein L49, mitochondrial

MRPL49

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Mitochondrion

Mitochondrion

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ