Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-conjugating enzyme E2 variant 1

Gene

UBE2V1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.7 Publications

Miscellaneous

In human, TMEM189/KUA and UBE2V1/UEV1 are adjacent genes which can produce independent proteins and can also be fused to form a TMEM189-UBE2V1 hybrid protein.

GO - Molecular functioni

  • ubiquitin conjugating enzyme activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

BRENDAi2.3.2.B6 2681
ReactomeiR-HSA-168638 NOD1/2 Signaling Pathway
R-HSA-168927 TICAM1, RIP1-mediated IKK complex recruitment
R-HSA-202424 Downstream TCR signaling
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-445989 TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-HSA-450302 activated TAK1 mediates p38 MAPK activation
R-HSA-450321 JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-9020702 Interleukin-1 signaling
R-HSA-937039 IRAK1 recruits IKK complex
R-HSA-937041 IKK complex recruitment mediated by RIP1
R-HSA-975110 TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
R-HSA-975144 IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ13404
SIGNORiQ13404

Protein family/group databases

MoonDBiQ13404 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-conjugating enzyme E2 variant 1
Short name:
UEV-1
Alternative name(s):
CROC-1
TRAF6-regulated IKK activator 1 beta Uev1A
Gene namesi
Name:UBE2V1
Synonyms:CROC1, UBE2V, UEV1
ORF Names:P/OKcl.19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000244687.11
HGNCiHGNC:12494 UBE2V1
MIMi602995 gene
neXtProtiNX_Q13404

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi387521
387522
7335
OpenTargetsiENSG00000244687
PharmGKBiPA37142

Polymorphism and mutation databases

BioMutaiUBE2V1
DMDMi259016163

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00000826002 – 147Ubiquitin-conjugating enzyme E2 variant 1Add BLAST146

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ13404
MaxQBiQ13404
PaxDbiQ13404
PeptideAtlasiQ13404
PRIDEiQ13404
ProteomicsDBi59382
59383 [Q13404-1]
59384 [Q13404-2]
59385 [Q13404-6]
59386 [Q13404-7]
TopDownProteomicsiQ13404-4 [Q13404-4]

PTM databases

iPTMnetiQ13404
PhosphoSitePlusiQ13404
SwissPalmiQ13404

Expressioni

Tissue specificityi

Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung.2 Publications

Inductioni

Down-regulated during differentiation of cultured colon adenocarcinoma cells.1 Publication

Gene expression databases

BgeeiENSG00000244687 Expressed in 94 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ13404 baseline and differential
GenevisibleiQ13404 HS

Organism-specific databases

HPAiHPA052535
HPA053186

Interactioni

Subunit structurei

Heterodimer with UBE2N (PubMed:11057907, PubMed:16307917, PubMed:16893187). Interacts (UBE2V2-UBE2N heterodimer) with the E3 ligase STUB1 (via the U-box domain); the complex has a specific 'Lys-63'-linked polyubiquitination activity (PubMed:16307917). Interacts with TRAF6 (PubMed:11057907, PubMed:16307917).3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi113183, 85 interactors
132321, 17 interactors
ComplexPortaliCPX-485 UBC13-UEV1A ubiquitin-conjugating enzyme E2 complex
CORUMiQ13404
DIPiDIP-41911N
IntActiQ13404, 122 interactors
MINTiQ13404
STRINGi9606.ENSP00000340305

Structurei

Secondary structure

1147
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ13404
SMRiQ13404
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13404

Family & Domainsi

Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0896 Eukaryota
ENOG4111MDW LUCA
GeneTreeiENSGT00740000115534
HOGENOMiHOG000036561
HOVERGENiHBG054552
InParanoidiQ13404
KOiK10704
K20656
OMAiGHTVHEN
OrthoDBiEOG091G0SMT
TreeFamiTF316971

Family and domain databases

Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q13404-4) [UniParc]FASTAAdd to basket
Also known as: Isoform 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAATTGSGVK VPRNFRLLEE LEEGQKGVGD GTVSWGLEDD EDMTLTRWTG
60 70 80 90 100
MIIGPPRTIY ENRIYSLKIE CGPKYPEAPP FVRFVTKINM NGVNSSNGVV
110 120 130 140
DPRAISVLAK WQNSYSIKVV LQELRRLMMS KENMKLPQPP EGQCYSN
Length:147
Mass (Da):16,495
Last modified:September 22, 2009 - v2
Checksum:iBA53837F21977B3F
GO
Isoform 1 (identifier: Q13404-1) [UniParc]FASTAAdd to basket
Also known as: CROC-1B, UEV-1B, Isoform 4

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAATTGS → MAYKFRTHSP...PHETYFCITT

Show »
Length:221
Mass (Da):25,797
Checksum:i6EE5C0FCC8CBBEE6
GO
Isoform 2 (identifier: Q13404-2) [UniParc]FASTAAdd to basket
Also known as: CROC-1A, UEV-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MAATTGSGVKVPRN → MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGSKSPSQ

Show »
Length:170
Mass (Da):19,228
Checksum:i9D3A8AC1EBEB22A6
GO
Isoform 4 (identifier: Q13404-6) [UniParc]FASTAAdd to basket
Also known as: UEV-1As

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: Missing.
     45-57: LTRWTGMIIGPPR → MKEDLNLENFTAK

Show »
Length:103
Mass (Da):11,842
Checksum:i76C152A73DE9AC40
GO
Isoform 5 (identifier: Q13404-7) [UniParc]FASTAAdd to basket
Also known as: Isoform 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAATTGS → MPGEVQASYLKSQSKLSDEGRLEPRKFHCK

Show »
Length:170
Mass (Da):19,307
Checksum:i5B2E8C6FFDF51510
GO
Isoform 6 (identifier: Q13404-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-99: Missing.

Note: No experimental confirmation available.
Show »
Length:105
Mass (Da):11,766
Checksum:iD7C2659FBA3FC719
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V2F7G3V2F7_HUMAN
Ubiquitin-conjugating enzyme E2 var...
UBE2V1
105Annotation score:
A0A0A0MSL3A0A0A0MSL3_HUMAN
Ubiquitin-conjugating enzyme E2 var...
UBE2V1
103Annotation score:
D6RG00D6RG00_HUMAN
HCG2018358, isoform CRA_d
UBE2V1 hCG_2018358
89Annotation score:

Sequence cautioni

The sequence AAH08944 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 1 (identifier: Q13404-1)
Sequence conflicti71 – 81SPHETYFCITT → WPTSSAQCYSP in AAC02755 (PubMed:9418904).CuratedAdd BLAST11

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0380321 – 44Missing in isoform 4. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0380331 – 14MAATT…KVPRN → MPGEVQASYLKSQSKLSDEG RLEPRKFHCKGSKSPSQ in isoform 2. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_0380341 – 7MAATTGS → MAYKFRTHSPEALEQLYPWE CFVFCLIIFGTFTNQIHKWS HTYFGLPRWVTLLQDWHVIL PRKHHRIHHVSPHETYFCIT T in isoform 1. 3 Publications7
Alternative sequenceiVSP_0380351 – 7MAATTGS → MPGEVQASYLKSQSKLSDEG RLEPRKFHCK in isoform 5. 1 Publication7
Alternative sequenceiVSP_03803645 – 57LTRWT…IGPPR → MKEDLNLENFTAK in isoform 4. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_04481858 – 99Missing in isoform 6. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U39360 mRNA Translation: AAB72015.1
U39361 mRNA Translation: AAB72016.1
U49278 mRNA Translation: AAC02757.1
U97279 mRNA Translation: AAC02780.1
U97280 mRNA Translation: AAC02755.1
U97281 mRNA Translation: AAC02756.1
AY008273 mRNA Translation: AAG24229.1
BT007382 mRNA Translation: AAP36046.1
DA580976 mRNA No translation available.
AL034423 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75635.1
CH471077 Genomic DNA Translation: EAW75634.1
CH471077 Genomic DNA Translation: EAW75636.1
BC000468 mRNA Translation: AAH00468.1
BC008944 mRNA Translation: AAH08944.2 Different initiation.
CCDSiCCDS13426.1 [Q13404-7]
CCDS13427.1 [Q13404-6]
CCDS33483.1 [Q13404-4]
CCDS58775.1 [Q13404-8]
RefSeqiNP_001027459.1, NM_001032288.2 [Q13404-4]
NP_001244322.1, NM_001257393.1 [Q13404-7]
NP_001244323.1, NM_001257394.1 [Q13404-6]
NP_001244325.1, NM_001257396.1 [Q13404-8]
NP_068823.2, NM_021988.5 [Q13404-7]
NP_071887.1, NM_022442.5 [Q13404-6]
NP_954595.1, NM_199144.2 [Q13404-7]
NP_954673.1, NM_199203.2
UniGeneiHs.420529
Hs.744839

Genome annotation databases

EnsembliENST00000340309; ENSP00000340305; ENSG00000244687 [Q13404-7]
ENST00000371657; ENSP00000360720; ENSG00000244687 [Q13404-8]
ENST00000371674; ENSP00000360739; ENSG00000244687 [Q13404-4]
ENST00000371677; ENSP00000360742; ENSG00000244687 [Q13404-7]
ENST00000415862; ENSP00000407770; ENSG00000244687 [Q13404-6]
GeneIDi387522
7335
KEGGihsa:387522
hsa:7335
UCSCiuc002xva.5 human [Q13404-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U39360 mRNA Translation: AAB72015.1
U39361 mRNA Translation: AAB72016.1
U49278 mRNA Translation: AAC02757.1
U97279 mRNA Translation: AAC02780.1
U97280 mRNA Translation: AAC02755.1
U97281 mRNA Translation: AAC02756.1
AY008273 mRNA Translation: AAG24229.1
BT007382 mRNA Translation: AAP36046.1
DA580976 mRNA No translation available.
AL034423 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75635.1
CH471077 Genomic DNA Translation: EAW75634.1
CH471077 Genomic DNA Translation: EAW75636.1
BC000468 mRNA Translation: AAH00468.1
BC008944 mRNA Translation: AAH08944.2 Different initiation.
CCDSiCCDS13426.1 [Q13404-7]
CCDS13427.1 [Q13404-6]
CCDS33483.1 [Q13404-4]
CCDS58775.1 [Q13404-8]
RefSeqiNP_001027459.1, NM_001032288.2 [Q13404-4]
NP_001244322.1, NM_001257393.1 [Q13404-7]
NP_001244323.1, NM_001257394.1 [Q13404-6]
NP_001244325.1, NM_001257396.1 [Q13404-8]
NP_068823.2, NM_021988.5 [Q13404-7]
NP_071887.1, NM_022442.5 [Q13404-6]
NP_954595.1, NM_199144.2 [Q13404-7]
NP_954673.1, NM_199203.2
UniGeneiHs.420529
Hs.744839

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A4DX-ray1.69A8-147[»]
2C2VX-ray2.90C/F/I/L8-147[»]
2HLWNMR-A8-147[»]
ProteinModelPortaliQ13404
SMRiQ13404
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113183, 85 interactors
132321, 17 interactors
ComplexPortaliCPX-485 UBC13-UEV1A ubiquitin-conjugating enzyme E2 complex
CORUMiQ13404
DIPiDIP-41911N
IntActiQ13404, 122 interactors
MINTiQ13404
STRINGi9606.ENSP00000340305

Protein family/group databases

MoonDBiQ13404 Predicted

PTM databases

iPTMnetiQ13404
PhosphoSitePlusiQ13404
SwissPalmiQ13404

Polymorphism and mutation databases

BioMutaiUBE2V1
DMDMi259016163

Proteomic databases

EPDiQ13404
MaxQBiQ13404
PaxDbiQ13404
PeptideAtlasiQ13404
PRIDEiQ13404
ProteomicsDBi59382
59383 [Q13404-1]
59384 [Q13404-2]
59385 [Q13404-6]
59386 [Q13404-7]
TopDownProteomicsiQ13404-4 [Q13404-4]

Protocols and materials databases

DNASUi387522
7335
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340309; ENSP00000340305; ENSG00000244687 [Q13404-7]
ENST00000371657; ENSP00000360720; ENSG00000244687 [Q13404-8]
ENST00000371674; ENSP00000360739; ENSG00000244687 [Q13404-4]
ENST00000371677; ENSP00000360742; ENSG00000244687 [Q13404-7]
ENST00000415862; ENSP00000407770; ENSG00000244687 [Q13404-6]
GeneIDi387522
7335
KEGGihsa:387522
hsa:7335
UCSCiuc002xva.5 human [Q13404-4]

Organism-specific databases

CTDi387522
7335
DisGeNETi387521
387522
7335
EuPathDBiHostDB:ENSG00000244687.11
GeneCardsiUBE2V1
HGNCiHGNC:12494 UBE2V1
HPAiHPA052535
HPA053186
MIMi602995 gene
neXtProtiNX_Q13404
OpenTargetsiENSG00000244687
PharmGKBiPA37142
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0896 Eukaryota
ENOG4111MDW LUCA
GeneTreeiENSGT00740000115534
HOGENOMiHOG000036561
HOVERGENiHBG054552
InParanoidiQ13404
KOiK10704
K20656
OMAiGHTVHEN
OrthoDBiEOG091G0SMT
TreeFamiTF316971

Enzyme and pathway databases

BRENDAi2.3.2.B6 2681
ReactomeiR-HSA-168638 NOD1/2 Signaling Pathway
R-HSA-168927 TICAM1, RIP1-mediated IKK complex recruitment
R-HSA-202424 Downstream TCR signaling
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-445989 TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-HSA-450302 activated TAK1 mediates p38 MAPK activation
R-HSA-450321 JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-9020702 Interleukin-1 signaling
R-HSA-937039 IRAK1 recruits IKK complex
R-HSA-937041 IKK complex recruitment mediated by RIP1
R-HSA-975110 TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
R-HSA-975144 IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ13404
SIGNORiQ13404

Miscellaneous databases

ChiTaRSiUBE2V1 human
EvolutionaryTraceiQ13404
GeneWikiiUBE2V1
PROiPR:Q13404
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000244687 Expressed in 94 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ13404 baseline and differential
GenevisibleiQ13404 HS

Family and domain databases

Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUB2V1_HUMAN
AccessioniPrimary (citable) accession number: Q13404
Secondary accession number(s): E1P629
, Q13403, Q13532, Q5TGE0, Q5TGE3, Q96H34, Q9GZT0, Q9GZW1, Q9H4J3, Q9H4J4, Q9UKL1, Q9UM48, Q9UM49, Q9UM50
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: September 22, 2009
Last modified: November 7, 2018
This is version 188 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again