Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13404 (UB2V1_HUMAN)

Entry version 202 (10 Feb 2021)
Sequence version 2 (22 Sep 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Ubiquitin-conjugating enzyme E2 variant 1

Gene

UBE2V1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production (PubMed:31006531). UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway.9 Publications

Miscellaneous

In human, PESD1/KUA and UBE2V1/UEV1 are adjacent genes which can produce independent proteins and can also be fused to form a PESD1-UBE2V1 hybrid protein.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.3.2.B6, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q13404

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-168638, NOD1/2 Signaling Pathway
R-HSA-168927, TICAM1, RIP1-mediated IKK complex recruitment
R-HSA-202424, Downstream TCR signaling
R-HSA-2871837, FCERI mediated NF-kB activation
R-HSA-445989, TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-HSA-450302, activated TAK1 mediates p38 MAPK activation
R-HSA-450321, JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
R-HSA-5607764, CLEC7A (Dectin-1) signaling
R-HSA-9020702, Interleukin-1 signaling
R-HSA-937039, IRAK1 recruits IKK complex
R-HSA-937041, IKK complex recruitment mediated by RIP1
R-HSA-9646399, Aggrephagy
R-HSA-975110, TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
R-HSA-975144, IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q13404

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q13404

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q13404, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin-conjugating enzyme E2 variant 1
Short name:
UEV-1
Alternative name(s):
CROC-1
TRAF6-regulated IKK activator 1 beta Uev1A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBE2V1
Synonyms:CROC1, UBE2V, UEV1
ORF Names:P/OKcl.19
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12494, UBE2V1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602995, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13404

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000244687.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		387522
7335

Open Targets

More...OpenTargetsi		ENSG00000244687

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37142

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13404, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		UBE2V1

Domain mapping of disease mutations (DMDM)

More...DMDMi		259016163

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000826002 – 147Ubiquitin-conjugating enzyme E2 variant 1Add BLAST146

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q13404

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q13404

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q13404

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q13404

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13404

PeptideAtlas

More...PeptideAtlasi		Q13404

PRoteomics IDEntifications database

More...PRIDEi		Q13404

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		59382 [Q13404-4]
59383 [Q13404-1]
59384 [Q13404-2]
59385 [Q13404-6]
59386 [Q13404-7]
65114

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q13404-4 [Q13404-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13404

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13404

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q13404

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated during differentiation of cultured colon adenocarcinoma cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000244687, Expressed in frontal cortex and 118 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13404, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13404, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000244687, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with UBE2N (PubMed:11057907, PubMed:16307917, PubMed:16893187).

Interacts (UBE2V2-UBE2N heterodimer) with the E3 ligase STUB1 (via the U-box domain); the complex has a specific 'Lys-63'-linked polyubiquitination activity (PubMed:16307917).

Interacts with TRAF6 (PubMed:11057907, PubMed:16307917).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113183, 97 interactors
132321, 33 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-485, UBC13-UEV1A ubiquitin-conjugating enzyme E2 complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q13404

Database of interacting proteins

More...DIPi		DIP-41911N

Protein interaction database and analysis system

More...IntActi		Q13404, 136 interactors

Molecular INTeraction database

More...MINTi		Q13404

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000340305

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q13404, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1147
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q13404

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13404

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q13404

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 147UBC corePROSITE-ProRule annotationAdd BLAST136

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0896, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00740000115534

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_063065_1_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13404

Identification of Orthologs from Complete Genome Data

More...OMAi		FTMETIL

Database of Orthologous Groups

More...OrthoDBi		1507995at2759

TreeFam database of animal gene trees

More...TreeFami		TF316971

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.10.110.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000608, UBQ-conjugat_E2
IPR016135, UBQ-conjugating_enzyme/RWD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00179, UQ_con, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54495, SSF54495, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50127, UBC_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q13404-4) [UniParc]FASTAAdd to basket
Also known as: Isoform 2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAATTGSGVK VPRNFRLLEE LEEGQKGVGD GTVSWGLEDD EDMTLTRWTG 
        60         70         80         90        100
MIIGPPRTIY ENRIYSLKIE CGPKYPEAPP FVRFVTKINM NGVNSSNGVV 
       110        120        130        140 
DPRAISVLAK WQNSYSIKVV LQELRRLMMS KENMKLPQPP EGQCYSN
Length:147
Mass (Da):16,495
Last modified:September 22, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBA53837F21977B3F
GO
Isoform 1 (identifier: Q13404-1) [UniParc]FASTAAdd to basket
Also known as: CROC-1B, UEV-1B, Isoform 4

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAATTGS → MAYKFRTHSP...PHETYFCITT

Show »
Length:221
Mass (Da):25,797
Checksum:i6EE5C0FCC8CBBEE6
GO
Isoform 2 (identifier: Q13404-2) [UniParc]FASTAAdd to basket
Also known as: CROC-1A, UEV-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MAATTGSGVKVPRN → MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGSKSPSQ

Show »
Length:170
Mass (Da):19,228
Checksum:i9D3A8AC1EBEB22A6
GO
Isoform 4 (identifier: Q13404-6) [UniParc]FASTAAdd to basket
Also known as: UEV-1As

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: Missing.
     45-57: LTRWTGMIIGPPR → MKEDLNLENFTAK

Show »
Length:103
Mass (Da):11,842
Checksum:i76C152A73DE9AC40
GO
Isoform 5 (identifier: Q13404-7) [UniParc]FASTAAdd to basket
Also known as: Isoform 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAATTGS → MPGEVQASYLKSQSKLSDEGRLEPRKFHCK

Show »
Length:170
Mass (Da):19,307
Checksum:i5B2E8C6FFDF51510
GO
Isoform 6 (identifier: Q13404-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-99: Missing.

Show »
Length:105
Mass (Da):11,766
Checksum:iD7C2659FBA3FC719
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RG00D6RG00_HUMAN
HCG2018358, isoform CRA_d
UBE2V1 hCG_2018358
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2F7G3V2F7_HUMAN
Ubiquitin-conjugating enzyme E2 var...
UBE2V1
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSL3A0A0A0MSL3_HUMAN
Ubiquitin-conjugating enzyme E2 var...
UBE2V1
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH08944 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 1 (identifier: Q13404-1)
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti71 – 81SPHETYFCITT → WPTSSAQCYSP in AAC02755 (PubMed:9418904).CuratedAdd BLAST11

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0380321 – 44Missing in isoform 4. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0380331 – 14MAATT…KVPRN → MPGEVQASYLKSQSKLSDEG RLEPRKFHCKGSKSPSQ in isoform 2. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_0380341 – 7MAATTGS → MAYKFRTHSPEALEQLYPWE CFVFCLIIFGTFTNQIHKWS HTYFGLPRWVTLLQDWHVIL PRKHHRIHHVSPHETYFCIT T in isoform 1. 3 Publications7
Alternative sequenceiVSP_0380351 – 7MAATTGS → MPGEVQASYLKSQSKLSDEG RLEPRKFHCK in isoform 5. 1 Publication7
Alternative sequenceiVSP_03803645 – 57LTRWT…IGPPR → MKEDLNLENFTAK in isoform 4. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_04481858 – 99Missing in isoform 6. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U39360 mRNA Translation: AAB72015.1
U39361 mRNA Translation: AAB72016.1
U49278 mRNA Translation: AAC02757.1
U97279 mRNA Translation: AAC02780.1
U97280 mRNA Translation: AAC02755.1
U97281 mRNA Translation: AAC02756.1
AY008273 mRNA Translation: AAG24229.1
BT007382 mRNA Translation: AAP36046.1
DA580976 mRNA No translation available.
AL034423 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75635.1
CH471077 Genomic DNA Translation: EAW75634.1
CH471077 Genomic DNA Translation: EAW75636.1
BC000468 mRNA Translation: AAH00468.1
BC008944 mRNA Translation: AAH08944.2 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13426.1 [Q13404-7]
CCDS13427.1 [Q13404-6]
CCDS33483.1 [Q13404-4]
CCDS58775.1 [Q13404-8]

NCBI Reference Sequences

More...RefSeqi		NP_001027459.1, NM_001032288.2 [Q13404-4]
NP_001244322.1, NM_001257393.1 [Q13404-7]
NP_001244323.1, NM_001257394.1 [Q13404-6]
NP_001244325.1, NM_001257396.1 [Q13404-8]
NP_068823.2, NM_021988.5 [Q13404-7]
NP_071887.1, NM_022442.5 [Q13404-6]
NP_954595.1, NM_199144.2 [Q13404-7]
NP_954673.1, NM_199203.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000340309; ENSP00000340305; ENSG00000244687 [Q13404-7]
ENST00000371657; ENSP00000360720; ENSG00000244687 [Q13404-8]
ENST00000371674; ENSP00000360739; ENSG00000244687 [Q13404-4]
ENST00000371677; ENSP00000360742; ENSG00000244687 [Q13404-7]
ENST00000415862; ENSP00000407770; ENSG00000244687 [Q13404-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		387522
7335

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:387522
hsa:7335

UCSC genome browser

More...UCSCi		uc002xva.5, human [Q13404-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U39360 mRNA Translation: AAB72015.1
U39361 mRNA Translation: AAB72016.1
U49278 mRNA Translation: AAC02757.1
U97279 mRNA Translation: AAC02780.1
U97280 mRNA Translation: AAC02755.1
U97281 mRNA Translation: AAC02756.1
AY008273 mRNA Translation: AAG24229.1
BT007382 mRNA Translation: AAP36046.1
DA580976 mRNA No translation available.
AL034423 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75635.1
CH471077 Genomic DNA Translation: EAW75634.1
CH471077 Genomic DNA Translation: EAW75636.1
BC000468 mRNA Translation: AAH00468.1
BC008944 mRNA Translation: AAH08944.2 Different initiation.
CCDSiCCDS13426.1 [Q13404-7]
CCDS13427.1 [Q13404-6]
CCDS33483.1 [Q13404-4]
CCDS58775.1 [Q13404-8]
RefSeqiNP_001027459.1, NM_001032288.2 [Q13404-4]
NP_001244322.1, NM_001257393.1 [Q13404-7]
NP_001244323.1, NM_001257394.1 [Q13404-6]
NP_001244325.1, NM_001257396.1 [Q13404-8]
NP_068823.2, NM_021988.5 [Q13404-7]
NP_071887.1, NM_022442.5 [Q13404-6]
NP_954595.1, NM_199144.2 [Q13404-7]
NP_954673.1, NM_199203.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A4DX-ray1.69A8-147[»]
2C2VX-ray2.90C/F/I/L8-147[»]
2HLWNMR-A8-147[»]
6D6IX-ray2.55A/D8-147[»]
BMRBiQ13404
SMRiQ13404
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113183, 97 interactors
132321, 33 interactors
ComplexPortaliCPX-485, UBC13-UEV1A ubiquitin-conjugating enzyme E2 complex
CORUMiQ13404
DIPiDIP-41911N
IntActiQ13404, 136 interactors
MINTiQ13404
STRINGi9606.ENSP00000340305

Protein family/group databases

MoonDBiQ13404, Predicted

PTM databases

iPTMnetiQ13404
PhosphoSitePlusiQ13404
SwissPalmiQ13404

Genetic variation databases

BioMutaiUBE2V1
DMDMi259016163

Proteomic databases

EPDiQ13404
jPOSTiQ13404
MassIVEiQ13404
MaxQBiQ13404
PaxDbiQ13404
PeptideAtlasiQ13404
PRIDEiQ13404
ProteomicsDBi59382 [Q13404-4]
59383 [Q13404-1]
59384 [Q13404-2]
59385 [Q13404-6]
59386 [Q13404-7]
65114
TopDownProteomicsiQ13404-4 [Q13404-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		35021, 258 antibodies

The DNASU plasmid repository

More...DNASUi		387522
7335

Genome annotation databases

EnsembliENST00000340309; ENSP00000340305; ENSG00000244687 [Q13404-7]
ENST00000371657; ENSP00000360720; ENSG00000244687 [Q13404-8]
ENST00000371674; ENSP00000360739; ENSG00000244687 [Q13404-4]
ENST00000371677; ENSP00000360742; ENSG00000244687 [Q13404-7]
ENST00000415862; ENSP00000407770; ENSG00000244687 [Q13404-6]
GeneIDi387522
7335
KEGGihsa:387522
hsa:7335
UCSCiuc002xva.5, human [Q13404-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		387522
7335
DisGeNETi387522
7335

GeneCards: human genes, protein and diseases

More...GeneCardsi		UBE2V1
HGNCiHGNC:12494, UBE2V1
HPAiENSG00000244687, Low tissue specificity
MIMi602995, gene
neXtProtiNX_Q13404
OpenTargetsiENSG00000244687
PharmGKBiPA37142
VEuPathDBiHostDB:ENSG00000244687.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0896, Eukaryota
GeneTreeiENSGT00740000115534
HOGENOMiCLU_063065_1_2_1
InParanoidiQ13404
OMAiFTMETIL
OrthoDBi1507995at2759
TreeFamiTF316971

Enzyme and pathway databases

BRENDAi2.3.2.B6, 2681
PathwayCommonsiQ13404
ReactomeiR-HSA-168638, NOD1/2 Signaling Pathway
R-HSA-168927, TICAM1, RIP1-mediated IKK complex recruitment
R-HSA-202424, Downstream TCR signaling
R-HSA-2871837, FCERI mediated NF-kB activation
R-HSA-445989, TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-HSA-450302, activated TAK1 mediates p38 MAPK activation
R-HSA-450321, JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
R-HSA-5607764, CLEC7A (Dectin-1) signaling
R-HSA-9020702, Interleukin-1 signaling
R-HSA-937039, IRAK1 recruits IKK complex
R-HSA-937041, IKK complex recruitment mediated by RIP1
R-HSA-9646399, Aggrephagy
R-HSA-975110, TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
R-HSA-975144, IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ13404
SIGNORiQ13404

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		387522, 65 hits in 822 CRISPR screens
7335, 212 hits in 856 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		UBE2V1, human
EvolutionaryTraceiQ13404

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		UBE2V1
PharosiQ13404, Tbio

Protein Ontology

More...PROi		PR:Q13404
RNActiQ13404, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000244687, Expressed in frontal cortex and 118 other tissues
ExpressionAtlasiQ13404, baseline and differential
GenevisibleiQ13404, HS

Family and domain databases

Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608, UBQ-conjugat_E2
IPR016135, UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179, UQ_con, 1 hit
SUPFAMiSSF54495, SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS50127, UBC_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUB2V1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13404
Secondary accession number(s): E1P629
, Q13403, Q13532, Q5TGE0, Q5TGE3, Q96H34, Q9GZT0, Q9GZW1, Q9H4J3, Q9H4J4, Q9UKL1, Q9UM48, Q9UM49, Q9UM50
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: September 22, 2009
Last modified: February 10, 2021
This is version 202 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again