Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipase D1

Gene

PLD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42. Inhibited by oleate.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell motility Source: GO_Central
  • chemotaxis Source: ProtInc
  • inositol lipid-mediated signaling Source: InterPro
  • lipid catabolic process Source: UniProtKB-KW
  • neutrophil degranulation Source: Reactome
  • phosphatidic acid biosynthetic process Source: Reactome
  • Ras protein signal transduction Source: ProtInc
  • regulation of microvillus assembly Source: UniProtKB
  • regulation of synaptic vesicle cycle Source: SynGO
  • small GTPase mediated signal transduction Source: ProtInc

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS01185-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.4 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1483148 Synthesis of PG
R-HSA-1483166 Synthesis of PA
R-HSA-2029485 Role of phospholipids in phagocytosis
R-HSA-6798695 Neutrophil degranulation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q13393

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13393

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000149

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipase D1 (EC:3.1.4.4)
Short name:
PLD 1
Short name:
hPLD1
Alternative name(s):
Choline phosphatase 1
Phosphatidylcholine-hydrolyzing phospholipase D1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLD1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000075651.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9067 PLD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602382 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13393

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cardiac valvular defect, developmental (CVDD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive form of congenital heart defects, characterized by valvular malformations involving the pulmonic, tricuspid and mitral valves.
See also OMIM:212093
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_078985442H → P in CVDD. 1 PublicationCorresponds to variant dbSNP:rs769669104EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
5337

MalaCards human disease database

More...
MalaCardsi
PLD1
MIMi212093 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000075651

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164742228

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2536

Drug and drug target database

More...
DrugBanki
DB00122 Choline
DB05301 LAX-101
DB09031 Miltefosine

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1433

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2499703

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002188021 – 1074Phospholipase D1Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi240S-palmitoyl cysteineBy similarity1
Lipidationi241S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei499PhosphoserineBy similarity1
Modified residuei561PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13393

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13393

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13393

PeptideAtlas

More...
PeptideAtlasi
Q13393

PRoteomics IDEntifications database

More...
PRIDEi
Q13393

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59360
59361 [Q13393-2]
59362 [Q13393-3]
59363 [Q13393-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q13393-2 [Q13393-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13393

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13393

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q13393

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed abundantly in the pancreas and heart and at high levels in brain, placenta, spleen, uterus and small intestine.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000075651 Expressed in 198 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_PLD1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13393 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13393 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004527
HPA042396

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PIP5K1B.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111353, 45 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q13393

Database of interacting proteins

More...
DIPi
DIP-40821N

Protein interaction database and analysis system

More...
IntActi
Q13393, 17 interactors

Molecular INTeraction database

More...
MINTi
Q13393

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342793

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q13393

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q13393

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13393

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 212PXPROSITE-ProRule annotationAdd BLAST132
Domaini219 – 328PHAdd BLAST110
Domaini459 – 486PLD phosphodiesterase 1PROSITE-ProRule annotationAdd BLAST28
Domaini891 – 918PLD phosphodiesterase 2PROSITE-ProRule annotationAdd BLAST28

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni463 – 928CatalyticAdd BLAST466

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the phospholipase D family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1329 Eukaryota
COG1502 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155015

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000246972

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006650

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13393

KEGG Orthology (KO)

More...
KOi
K01115

Identification of Orthologs from Complete Genome Data

More...
OMAi
LRWNFVK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G017Y

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13393

TreeFam database of animal gene trees

More...
TreeFami
TF300589

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001683 Phox
IPR025202 PLD-like_dom
IPR001736 PLipase_D/transphosphatidylase
IPR016555 PLipase_D_euk
IPR015679 PLipase_D_fam
IPR036871 PX_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR18896 PTHR18896, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169 PH, 1 hit
PF00614 PLDc, 1 hit
PF13091 PLDc_2, 1 hit
PF00787 PX, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF009376 Phospholipase_D_euk, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00155 PLDc, 2 hits
SM00312 PX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF64268 SSF64268, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50035 PLD, 2 hits
PS50195 PX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform PLD1A (identifier: Q13393-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLKNEPRVN TSALQKIAAD MSNIIENLDT RELHFEGEEV DYDVSPSDPK
60 70 80 90 100
IQEVYIPFSA IYNTQGFKEP NIQTYLSGCP IKAQVLEVER FTSTTRVPSI
110 120 130 140 150
NLYTIELTHG EFKWQVKRKF KHFQEFHREL LKYKAFIRIP IPTRRHTFRR
160 170 180 190 200
QNVREEPREM PSLPRSSENM IREEQFLGRR KQLEDYLTKI LKMPMYRNYH
210 220 230 240 250
ATTEFLDISQ LSFIHDLGPK GIEGMIMKRS GGHRIPGLNC CGQGRACYRW
260 270 280 290 300
SKRWLIVKDS FLLYMKPDSG AIAFVLLVDK EFKIKVGKKE TETKYGIRID
310 320 330 340 350
NLSRTLILKC NSYRHARWWG GAIEEFIQKH GTNFLKDHRF GSYAAIQENA
360 370 380 390 400
LAKWYVNAKG YFEDVANAME EANEEIFITD WWLSPEIFLK RPVVEGNRWR
410 420 430 440 450
LDCILKRKAQ QGVRIFIMLY KEVELALGIN SEYTKRTLMR LHPNIKVMRH
460 470 480 490 500
PDHVSSTVYL WAHHEKLVII DQSVAFVGGI DLAYGRWDDN EHRLTDVGSV
510 520 530 540 550
KRVTSGPSLG SLPPAAMESM ESLRLKDKNE PVQNLPIQKS IDDVDSKLKG
560 570 580 590 600
IGKPRKFSKF SLYKQLHRHH LHDADSISSI DSTSSYFNHY RSHHNLIHGL
610 620 630 640 650
KPHFKLFHPS SESEQGLTRP HADTGSIRSL QTGVGELHGE TRFWHGKDYC
660 670 680 690 700
NFVFKDWVQL DKPFADFIDR YSTPRMPWHD IASAVHGKAA RDVARHFIQR
710 720 730 740 750
WNFTKIMKSK YRSLSYPFLL PKSQTTAHEL RYQVPGSVHA NVQLLRSAAD
760 770 780 790 800
WSAGIKYHEE SIHAAYVHVI ENSRHYIYIE NQFFISCADD KVVFNKIGDA
810 820 830 840 850
IAQRILKAHR ENQKYRVYVV IPLLPGFEGD ISTGGGNALQ AIMHFNYRTM
860 870 880 890 900
CRGENSILGQ LKAELGNQWI NYISFCGLRT HAELEGNLVT ELIYVHSKLL
910 920 930 940 950
IADDNTVIIG SANINDRSML GKRDSEMAVI VQDTETVPSV MDGKEYQAGR
960 970 980 990 1000
FARGLRLQCF RVVLGYLDDP SEDIQDPVSD KFFKEVWVST AARNATIYDK
1010 1020 1030 1040 1050
VFRCLPNDEV HNLIQLRDFI NKPVLAKEDP IRAEEELKKI RGFLVQFPFY
1060 1070
FLSEESLLPS VGTKEAIVPM EVWT
Length:1,074
Mass (Da):124,184
Last modified:November 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i734F285790A0BF7A
GO
Isoform PLD1B (identifier: Q13393-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-623: SYFNHYRSHHNLIHGLKPHFKLFHPSSESEQGLTRPHAD → N

Show »
Length:1,036
Mass (Da):119,693
Checksum:i7AFA088570479777
GO
Isoform PLD1C (identifier: Q13393-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     514-597: PAAMESMESL...NHYRSHHNLI → IPGPSVVYRQ...SSSAGTSQKL
     598-1074: Missing.

Show »
Length:597
Mass (Da):68,898
Checksum:iBA03FFD5DD72AED7
GO
Isoform PLD1D (identifier: Q13393-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     962-971: VVLGYLDDPS → SKMTPGVEDP
     972-1074: Missing.

Show »
Length:971
Mass (Da):112,184
Checksum:i0B7F963953A48ECC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IY79C9IY79_HUMAN
Phospholipase D1
PLD1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0L3H7C0L3_HUMAN
Phospholipase D1
PLD1
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8WYW5Q8WYW5_HUMAN
Phospholipase D1
PLD1 pp13439
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBV7F8WBV7_HUMAN
Phospholipase D1
PLD1
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti832S → P in CAB76564 (PubMed:9761774).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03438749P → A. Corresponds to variant dbSNP:rs9819927Ensembl.1
Natural variantiVAR_078985442H → P in CVDD. 1 PublicationCorresponds to variant dbSNP:rs769669104EnsemblClinVar.1
Natural variantiVAR_022056622A → S. Corresponds to variant dbSNP:rs2290480Ensembl.1
Natural variantiVAR_022057820V → M. Corresponds to variant dbSNP:rs2287579Ensembl.1
Natural variantiVAR_0517031024V → I. Corresponds to variant dbSNP:rs9827333Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005018514 – 597PAAME…HHNLI → IPGPSVVYRQVWESCMGKPD SGMERTTAISSSKTGFNLIN LLLISLTGTPRPGCPGMTLP LQSTGRRLVMWHVTSSSAGT SQKL in isoform PLD1C. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_005020585 – 623SYFNH…RPHAD → N in isoform PLD1B. 2 PublicationsAdd BLAST39
Alternative sequenceiVSP_005019598 – 1074Missing in isoform PLD1C. 1 PublicationAdd BLAST477
Alternative sequenceiVSP_005021962 – 971VVLGYLDDPS → SKMTPGVEDP in isoform PLD1D. 1 Publication10
Alternative sequenceiVSP_005022972 – 1074Missing in isoform PLD1D. 1 PublicationAdd BLAST103

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U38545 mRNA Translation: AAB49031.1
BC068976 mRNA Translation: AAH68976.1
AJ276230 mRNA Translation: CAB76564.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3216.1 [Q13393-1]
CCDS46957.1 [Q13393-2]

NCBI Reference Sequences

More...
RefSeqi
NP_002653.1, NM_002662.4 [Q13393-1]
XP_005247590.1, XM_005247533.2 [Q13393-1]
XP_005247591.1, XM_005247534.2 [Q13393-2]
XP_011511199.1, XM_011512897.1 [Q13393-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.382865
Hs.732969

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000351298; ENSP00000342793; ENSG00000075651 [Q13393-1]
ENST00000356327; ENSP00000348681; ENSG00000075651 [Q13393-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5337

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5337

UCSC genome browser

More...
UCSCi
uc003fhs.4 human [Q13393-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Phospholipase D entry

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U38545 mRNA Translation: AAB49031.1
BC068976 mRNA Translation: AAH68976.1
AJ276230 mRNA Translation: CAB76564.1
CCDSiCCDS3216.1 [Q13393-1]
CCDS46957.1 [Q13393-2]
RefSeqiNP_002653.1, NM_002662.4 [Q13393-1]
XP_005247590.1, XM_005247533.2 [Q13393-1]
XP_005247591.1, XM_005247534.2 [Q13393-2]
XP_011511199.1, XM_011512897.1 [Q13393-4]
UniGeneiHs.382865
Hs.732969

3D structure databases

ProteinModelPortaliQ13393
SMRiQ13393
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111353, 45 interactors
CORUMiQ13393
DIPiDIP-40821N
IntActiQ13393, 17 interactors
MINTiQ13393
STRINGi9606.ENSP00000342793

Chemistry databases

BindingDBiQ13393
ChEMBLiCHEMBL2536
DrugBankiDB00122 Choline
DB05301 LAX-101
DB09031 Miltefosine
GuidetoPHARMACOLOGYi1433
SwissLipidsiSLP:000000149

PTM databases

iPTMnetiQ13393
PhosphoSitePlusiQ13393
SwissPalmiQ13393

Polymorphism and mutation databases

BioMutaiPLD1
DMDMi2499703

Proteomic databases

EPDiQ13393
MaxQBiQ13393
PaxDbiQ13393
PeptideAtlasiQ13393
PRIDEiQ13393
ProteomicsDBi59360
59361 [Q13393-2]
59362 [Q13393-3]
59363 [Q13393-4]
TopDownProteomicsiQ13393-2 [Q13393-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5337
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351298; ENSP00000342793; ENSG00000075651 [Q13393-1]
ENST00000356327; ENSP00000348681; ENSG00000075651 [Q13393-2]
GeneIDi5337
KEGGihsa:5337
UCSCiuc003fhs.4 human [Q13393-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5337
DisGeNETi5337
EuPathDBiHostDB:ENSG00000075651.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLD1
HGNCiHGNC:9067 PLD1
HPAiCAB004527
HPA042396
MalaCardsiPLD1
MIMi212093 phenotype
602382 gene
neXtProtiNX_Q13393
OpenTargetsiENSG00000075651
PharmGKBiPA164742228

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1329 Eukaryota
COG1502 LUCA
GeneTreeiENSGT00940000155015
HOGENOMiHOG000246972
HOVERGENiHBG006650
InParanoidiQ13393
KOiK01115
OMAiLRWNFVK
OrthoDBiEOG091G017Y
PhylomeDBiQ13393
TreeFamiTF300589

Enzyme and pathway databases

BioCyciMetaCyc:HS01185-MONOMER
BRENDAi3.1.4.4 2681
ReactomeiR-HSA-1483148 Synthesis of PG
R-HSA-1483166 Synthesis of PA
R-HSA-2029485 Role of phospholipids in phagocytosis
R-HSA-6798695 Neutrophil degranulation
SignaLinkiQ13393
SIGNORiQ13393

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLD1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Phospholipase_D1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5337

Protein Ontology

More...
PROi
PR:Q13393

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000075651 Expressed in 198 organ(s), highest expression level in corpus callosum
CleanExiHS_PLD1
ExpressionAtlasiQ13393 baseline and differential
GenevisibleiQ13393 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001683 Phox
IPR025202 PLD-like_dom
IPR001736 PLipase_D/transphosphatidylase
IPR016555 PLipase_D_euk
IPR015679 PLipase_D_fam
IPR036871 PX_dom_sf
PANTHERiPTHR18896 PTHR18896, 1 hit
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00614 PLDc, 1 hit
PF13091 PLDc_2, 1 hit
PF00787 PX, 1 hit
PIRSFiPIRSF009376 Phospholipase_D_euk, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00155 PLDc, 2 hits
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50035 PLD, 2 hits
PS50195 PX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLD1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13393
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: December 5, 2018
This is version 187 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again