Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-Jun-amino-terminal kinase-interacting protein 2

Gene

MAPK8IP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity).By similarity

GO - Molecular functioni

  • amyloid-beta binding Source: UniProtKB
  • kinesin binding Source: UniProtKB
  • MAP-kinase scaffold activity Source: UniProtKB
  • protein-containing complex binding Source: Ensembl
  • protein kinase activator activity Source: MGI
  • protein kinase binding Source: UniProtKB
  • structural molecule activity Source: ProtInc

GO - Biological processi

Enzyme and pathway databases

SignaLinkiQ13387
SIGNORiQ13387

Protein family/group databases

MoonDBiQ13387 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
C-Jun-amino-terminal kinase-interacting protein 2
Short name:
JIP-2
Short name:
JNK-interacting protein 2
Alternative name(s):
Islet-brain-2
Short name:
IB-2
JNK MAP kinase scaffold protein 2
Mitogen-activated protein kinase 8-interacting protein 2
Gene namesi
Name:MAPK8IP2
Synonyms:IB2, JIP2, PRKM8IPL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000008735.13
HGNCiHGNC:6883 MAPK8IP2
MIMi607755 gene
neXtProtiNX_Q13387

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi23542
OpenTargetsiENSG00000008735
PharmGKBiPA30627

Polymorphism and mutation databases

BioMutaiMAPK8IP2
DMDMi17433017

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002206311 – 824C-Jun-amino-terminal kinase-interacting protein 2Add BLAST824

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei254PhosphoserineBy similarity1
Modified residuei302PhosphoserineBy similarity1
Modified residuei305PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ13387
PeptideAtlasiQ13387
PRIDEiQ13387
ProteomicsDBi59356
59357 [Q13387-2]
59358 [Q13387-3]
59359 [Q13387-4]

PTM databases

iPTMnetiQ13387
PhosphoSitePlusiQ13387

Expressioni

Tissue specificityi

Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in uterus, ovary, prostate, colon, testis, adrenal gland, thyroid gland and salivary gland.

Gene expression databases

BgeeiENSG00000008735 Expressed in 182 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_MAPK8IP2
GenevisibleiQ13387 HS

Organism-specific databases

HPAiHPA034780

Interactioni

Subunit structurei

Forms homo- or heterooligomeric complexes. Binds specific components of the JNK signaling pathway namely JNK1, JNK2, JNK3, MAP2K7, MAP3K10, MAP3K11, MAP3K12 and MAPK13. Also binds the proline-rich domain-containing splice variant of apolipoprotein E receptor 2 (ApoER2). Binds the cytoplasmic tails of LRP1 and LRP2 (Megalin). Binds the TPR motif-containing C-terminal of kinesin light chain, Klc1, pre-assembled MAPK8IP1 scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location (By similarity). Interacts with the cytoplasmic domain of APP (By similarity). Interacts with DCLK2. Interacts with TIAM1 and TIAM2 (By similarity). Interacts with FGF13; enables the interaction with MAPK13 and may regulate the MAPK8IP2 scaffolding activity. Interacts with SH3RF2 (By similarity).By similarity2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117086, 95 interactors
IntActiQ13387, 72 interactors
MINTiQ13387
STRINGi9606.ENSP00000330572

Structurei

3D structure databases

ProteinModelPortaliQ13387
SMRiQ13387
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini604 – 665SH3PROSITE-ProRule annotationAdd BLAST62
Domaini677 – 813PIDPROSITE-ProRule annotationAdd BLAST137

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni110 – 275JNK-binding domain (JBD)Add BLAST166
Regioni239 – 498Necessary for interaction with FGF131 PublicationAdd BLAST260

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi30 – 36Asp/Glu-rich (acidic)7
Compositional biasi85 – 103Asp/Glu-rich (acidic)Add BLAST19
Compositional biasi279 – 291Ser-richAdd BLAST13
Compositional biasi417 – 434Pro-richAdd BLAST18
Compositional biasi469 – 481Asp/Glu-rich (acidic)Add BLAST13

Sequence similaritiesi

Belongs to the JIP scaffold family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3775 Eukaryota
ENOG410ZFRJ LUCA
GeneTreeiENSGT00390000003908
HOGENOMiHOG000231470
HOVERGENiHBG018568
InParanoidiQ13387
KOiK04435
OMAiHKHRPTT
OrthoDBiEOG091G0T9G
PhylomeDBiQ13387

Family and domain databases

CDDicd11942 SH3_JIP2, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035637 JIP2_SH3
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00640 PID, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00326 SH3, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
PS50002 SH3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q13387-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADRAEMFSL STFHSLSPPG CRPPQDISLE EFDDEDLSEI TDDCGLGLSY
60 70 80 90 100
DSDHCEKDSL SLGRSEQPHP ICSFQDDFQE FEMIDDNEEE DDEDEEEEEE
110 120 130 140 150
EEEGDGEGQE GGDPGSEAPA PGPLIPSPSV EEPHKHRPTT LRLTTLGAQD
160 170 180 190 200
SLNNNGGFDL VRPASWQETA LCSPAPEALR ELPGPLPATD TGPGGAQSPV
210 220 230 240 250
RPGCDCEGNR PAEPPAPGGT SPSSDPGIEA DLRSRSSGGR GGRRSSQELS
260 270 280 290 300
SPGSDSEDAG GARLGRMISS ISETELELSS DGGSSSSGRS SHLTNSIEEA
310 320 330 340 350
SSPASEPEPP REPPRRPAFL PVGPDDTNSE YESGSESEPD LSEDADSPWL
360 370 380 390 400
LSNLVSRMIS EGSSPIRCPG QCLSPAPRPP GEPVSPAGGA AQDSQDPEAA
410 420 430 440 450
AGPGGVELVD METLCAPPPP APAAPRPGPA QPGPCLFLSN PTRDTITPLW
460 470 480 490 500
AAPGRAARPG RACSAACSEE EDEEDDEEEE DAEDSAGSPG GRGTGPSAPR
510 520 530 540 550
DASLVYDAVK YTLVVDEHTQ LELVSLRRCA GLGHDSEEDS GGEASEEEAG
560 570 580 590 600
AALLGGGQVS GDTSPDSPDL TFSKKFLNVF VNSTSRSSST ESFGLFSCLV
610 620 630 640 650
NGEEREQTHR AVFRFIPRHP DELELDVDDP VLVEAEEDDF WFRGFNMRTG
660 670 680 690 700
ERGVFPAFYA HAVPGPAKDL LGSKRSPCWV ERFDVQFLGS VEVPCHQGNG
710 720 730 740 750
ILCAAMQKIA TARKLTVHLR PPASCDLEIS LRGVKLSLSG GGPEFQRCSH
760 770 780 790 800
FFQMKNISFC GCHPRNSCYF GFITKHPLLS RFACHVFVSQ ESMRPVAQSV
810 820
GRAFLEYYQE HLAYACPTED IYLE
Length:824
Mass (Da):87,975
Last modified:December 5, 2001 - v2
Checksum:i7EFC8F3BC58E37BB
GO
Isoform 2 (identifier: Q13387-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ

Show »
Length:797
Mass (Da):84,711
Checksum:i715D63743DF04E7B
GO
Isoform 3 (identifier: Q13387-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ
     152-394: Missing.
     415-439: Missing.
     768-768: C → CEAPQGAAFQWERGVDRKRVLQTRGNVQPHLGAGQGAALNRATEGSSTGSEKGEWTPLVIMELTQSVNSC

Note: Might be artifactual as it is only predicted from a genomic sequence.
Show »
Length:598
Mass (Da):64,934
Checksum:i863EA918E833DCAE
GO
Isoform 4 (identifier: Q13387-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-468: Missing.

Show »
Length:443
Mass (Da):49,070
Checksum:i6340E55966B6EFC3
GO

Sequence cautioni

The sequence CAA16714 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049666743P → L. Corresponds to variant dbSNP:rs1140555Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0027701 – 57MADRA…DHCEK → MLPDFPSPSTWAPGLLLPSG PALLSPSVLQ in isoform 2 and isoform 3. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_00277188 – 468Missing in isoform 4. 1 PublicationAdd BLAST381
Alternative sequenceiVSP_002772152 – 394Missing in isoform 3. CuratedAdd BLAST243
Alternative sequenceiVSP_002773415 – 439Missing in isoform 3. CuratedAdd BLAST25
Alternative sequenceiVSP_002774768C → CEAPQGAAFQWERGVDRKRV LQTRGNVQPHLGAGQGAALN RATEGSSTGSEKGEWTPLVI MELTQSVNSC in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF136382 mRNA Translation: AAF00980.1
AF218778 mRNA Translation: AAF32323.1
U62317 Genomic DNA Translation: AAB03340.1
BC009940 mRNA Translation: AAH09940.2
AL021708 mRNA Translation: CAA16714.1 Different initiation.
U79261 mRNA Translation: AAB50207.1
CCDSiCCDS74886.1 [Q13387-1]
RefSeqiNP_036456.1, NM_012324.4 [Q13387-1]
UniGeneiHs.558180
Hs.656617

Genome annotation databases

EnsembliENST00000329492; ENSP00000330572; ENSG00000008735 [Q13387-1]
GeneIDi23542
KEGGihsa:23542
UCSCiuc032qrw.2 human [Q13387-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF136382 mRNA Translation: AAF00980.1
AF218778 mRNA Translation: AAF32323.1
U62317 Genomic DNA Translation: AAB03340.1
BC009940 mRNA Translation: AAH09940.2
AL021708 mRNA Translation: CAA16714.1 Different initiation.
U79261 mRNA Translation: AAB50207.1
CCDSiCCDS74886.1 [Q13387-1]
RefSeqiNP_036456.1, NM_012324.4 [Q13387-1]
UniGeneiHs.558180
Hs.656617

3D structure databases

ProteinModelPortaliQ13387
SMRiQ13387
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117086, 95 interactors
IntActiQ13387, 72 interactors
MINTiQ13387
STRINGi9606.ENSP00000330572

Protein family/group databases

MoonDBiQ13387 Predicted

PTM databases

iPTMnetiQ13387
PhosphoSitePlusiQ13387

Polymorphism and mutation databases

BioMutaiMAPK8IP2
DMDMi17433017

Proteomic databases

PaxDbiQ13387
PeptideAtlasiQ13387
PRIDEiQ13387
ProteomicsDBi59356
59357 [Q13387-2]
59358 [Q13387-3]
59359 [Q13387-4]

Protocols and materials databases

DNASUi23542
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329492; ENSP00000330572; ENSG00000008735 [Q13387-1]
GeneIDi23542
KEGGihsa:23542
UCSCiuc032qrw.2 human [Q13387-1]

Organism-specific databases

CTDi23542
DisGeNETi23542
EuPathDBiHostDB:ENSG00000008735.13
GeneCardsiMAPK8IP2
HGNCiHGNC:6883 MAPK8IP2
HPAiHPA034780
MIMi607755 gene
neXtProtiNX_Q13387
OpenTargetsiENSG00000008735
PharmGKBiPA30627
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3775 Eukaryota
ENOG410ZFRJ LUCA
GeneTreeiENSGT00390000003908
HOGENOMiHOG000231470
HOVERGENiHBG018568
InParanoidiQ13387
KOiK04435
OMAiHKHRPTT
OrthoDBiEOG091G0T9G
PhylomeDBiQ13387

Enzyme and pathway databases

SignaLinkiQ13387
SIGNORiQ13387

Miscellaneous databases

ChiTaRSiMAPK8IP2 human
GeneWikiiMAPK8IP2
GenomeRNAii23542
PROiPR:Q13387
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000008735 Expressed in 182 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_MAPK8IP2
GenevisibleiQ13387 HS

Family and domain databases

CDDicd11942 SH3_JIP2, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035637 JIP2_SH3
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00640 PID, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00326 SH3, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiJIP2_HUMAN
AccessioniPrimary (citable) accession number: Q13387
Secondary accession number(s): Q96G62
, Q99771, Q9NZ59, Q9UKQ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: December 5, 2001
Last modified: September 12, 2018
This is version 163 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again