Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13387 (JIP2_HUMAN)

Entry version 179 (07 Apr 2021)
Sequence version 2 (05 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

C-Jun-amino-terminal kinase-interacting protein 2

Gene

MAPK8IP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q13387

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q13387

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q13387

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q13387, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-Jun-amino-terminal kinase-interacting protein 2
Short name:
JIP-2
Short name:
JNK-interacting protein 2
Alternative name(s):
Islet-brain-2
Short name:
IB-2
JNK MAP kinase scaffold protein 2
Mitogen-activated protein kinase 8-interacting protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAPK8IP2
Synonyms:IB2, JIP2, PRKM8IPL
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6883, MAPK8IP2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607755, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13387

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000008735.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		23542

Open Targets

More...OpenTargetsi		ENSG00000008735

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30627

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13387, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MAPK8IP2

Domain mapping of disease mutations (DMDM)

More...DMDMi		17433017

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002206311 – 824C-Jun-amino-terminal kinase-interacting protein 2Add BLAST824

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei254PhosphoserineBy similarity1
Modified residuei302PhosphoserineBy similarity1
Modified residuei305PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q13387

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13387

PeptideAtlas

More...PeptideAtlasi		Q13387

PRoteomics IDEntifications database

More...PRIDEi		Q13387

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		59356 [Q13387-1]
59357 [Q13387-2]
59358 [Q13387-3]
59359 [Q13387-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13387

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13387

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in uterus, ovary, prostate, colon, testis, adrenal gland, thyroid gland and salivary gland.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000008735, Expressed in anterior cingulate cortex and 195 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13387, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000008735, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms homo- or heterooligomeric complexes. Binds specific components of the JNK signaling pathway namely JNK1, JNK2, JNK3, MAP2K7, MAP3K10, MAP3K11, MAP3K12 and MAPK13. Also binds the proline-rich domain-containing splice variant of apolipoprotein E receptor 2 (ApoER2). Binds the cytoplasmic tails of LRP1 and LRP2 (Megalin). Binds the TPR motif-containing C-terminal of kinesin light chain, Klc1, pre-assembled MAPK8IP1 scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location (By similarity).

Interacts with the cytoplasmic domain of APP (By similarity).

Interacts with DCLK2.

Interacts with TIAM1 and TIAM2 (By similarity).

Interacts with FGF13; enables the interaction with MAPK13 and may regulate the MAPK8IP2 scaffolding activity.

Interacts with SH3RF2 (By similarity).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117086, 95 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q13387

Protein interaction database and analysis system

More...IntActi		Q13387, 84 interactors

Molecular INTeraction database

More...MINTi		Q13387

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000330572

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q13387, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13387

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini604 – 665SH3PROSITE-ProRule annotationAdd BLAST62
Domaini677 – 813PIDPROSITE-ProRule annotationAdd BLAST137

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni110 – 275JNK-binding domain (JBD)Add BLAST166
Regioni239 – 498Necessary for interaction with FGF131 PublicationAdd BLAST260

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi30 – 36Asp/Glu-rich (acidic)7
Compositional biasi85 – 103Asp/Glu-rich (acidic)Add BLAST19
Compositional biasi279 – 291Ser-richAdd BLAST13
Compositional biasi417 – 434Pro-richAdd BLAST18
Compositional biasi469 – 481Asp/Glu-rich (acidic)Add BLAST13

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the JIP scaffold family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3775, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160461

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_006711_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13387

Identification of Orthologs from Complete Genome Data

More...OMAi		CEGNRPA

Database of Orthologous Groups

More...OrthoDBi		372907at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q13387

Family and domain databases

Conserved Domains Database

More...CDDi		cd11942, SH3_JIP2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035637, JIP2_SH3
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR001452, SH3_domain

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00640, PID, 1 hit
PF14604, SH3_9, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00462, PTB, 1 hit
SM00326, SH3, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01179, PID, 1 hit
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q13387-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADRAEMFSL STFHSLSPPG CRPPQDISLE EFDDEDLSEI TDDCGLGLSY 
        60         70         80         90        100
DSDHCEKDSL SLGRSEQPHP ICSFQDDFQE FEMIDDNEEE DDEDEEEEEE 
       110        120        130        140        150
EEEGDGEGQE GGDPGSEAPA PGPLIPSPSV EEPHKHRPTT LRLTTLGAQD 
       160        170        180        190        200
SLNNNGGFDL VRPASWQETA LCSPAPEALR ELPGPLPATD TGPGGAQSPV 
       210        220        230        240        250
RPGCDCEGNR PAEPPAPGGT SPSSDPGIEA DLRSRSSGGR GGRRSSQELS 
       260        270        280        290        300
SPGSDSEDAG GARLGRMISS ISETELELSS DGGSSSSGRS SHLTNSIEEA 
       310        320        330        340        350
SSPASEPEPP REPPRRPAFL PVGPDDTNSE YESGSESEPD LSEDADSPWL 
       360        370        380        390        400
LSNLVSRMIS EGSSPIRCPG QCLSPAPRPP GEPVSPAGGA AQDSQDPEAA 
       410        420        430        440        450
AGPGGVELVD METLCAPPPP APAAPRPGPA QPGPCLFLSN PTRDTITPLW 
       460        470        480        490        500
AAPGRAARPG RACSAACSEE EDEEDDEEEE DAEDSAGSPG GRGTGPSAPR 
       510        520        530        540        550
DASLVYDAVK YTLVVDEHTQ LELVSLRRCA GLGHDSEEDS GGEASEEEAG 
       560        570        580        590        600
AALLGGGQVS GDTSPDSPDL TFSKKFLNVF VNSTSRSSST ESFGLFSCLV 
       610        620        630        640        650
NGEEREQTHR AVFRFIPRHP DELELDVDDP VLVEAEEDDF WFRGFNMRTG 
       660        670        680        690        700
ERGVFPAFYA HAVPGPAKDL LGSKRSPCWV ERFDVQFLGS VEVPCHQGNG 
       710        720        730        740        750
ILCAAMQKIA TARKLTVHLR PPASCDLEIS LRGVKLSLSG GGPEFQRCSH 
       760        770        780        790        800
FFQMKNISFC GCHPRNSCYF GFITKHPLLS RFACHVFVSQ ESMRPVAQSV 
       810        820 
GRAFLEYYQE HLAYACPTED IYLE
Length:824
Mass (Da):87,975
Last modified:December 5, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7EFC8F3BC58E37BB
GO
Isoform 2 (identifier: Q13387-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ

Show »
Length:797
Mass (Da):84,711
Checksum:i715D63743DF04E7B
GO
Isoform 3 (identifier: Q13387-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ
     152-394: Missing.
     415-439: Missing.
     768-768: C → CEAPQGAAFQWERGVDRKRVLQTRGNVQPHLGAGQGAALNRATEGSSTGSEKGEWTPLVIMELTQSVNSC

Note: Might be artifactual as it is only predicted from a genomic sequence.Curated
Show »
Length:598
Mass (Da):64,934
Checksum:i863EA918E833DCAE
GO
Isoform 4 (identifier: Q13387-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-468: Missing.

Show »
Length:443
Mass (Da):49,070
Checksum:i6340E55966B6EFC3
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA16714 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049666743P → L. Corresponds to variant dbSNP:rs1140555Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0027701 – 57MADRA…DHCEK → MLPDFPSPSTWAPGLLLPSG PALLSPSVLQ in isoform 2 and isoform 3. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_00277188 – 468Missing in isoform 4. 1 PublicationAdd BLAST381
Alternative sequenceiVSP_002772152 – 394Missing in isoform 3. CuratedAdd BLAST243
Alternative sequenceiVSP_002773415 – 439Missing in isoform 3. CuratedAdd BLAST25
Alternative sequenceiVSP_002774768C → CEAPQGAAFQWERGVDRKRV LQTRGNVQPHLGAGQGAALN RATEGSSTGSEKGEWTPLVI MELTQSVNSC in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF136382 mRNA Translation: AAF00980.1
AF218778 mRNA Translation: AAF32323.1
U62317 Genomic DNA Translation: AAB03340.1
BC009940 mRNA Translation: AAH09940.2
AL021708 mRNA Translation: CAA16714.1 Different initiation.
U79261 mRNA Translation: AAB50207.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS74886.1 [Q13387-1]

NCBI Reference Sequences

More...RefSeqi		NP_036456.1, NM_012324.4 [Q13387-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000329492; ENSP00000330572; ENSG00000008735 [Q13387-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23542

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23542

UCSC genome browser

More...UCSCi		uc032qrw.2, human [Q13387-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF136382 mRNA Translation: AAF00980.1
AF218778 mRNA Translation: AAF32323.1
U62317 Genomic DNA Translation: AAB03340.1
BC009940 mRNA Translation: AAH09940.2
AL021708 mRNA Translation: CAA16714.1 Different initiation.
U79261 mRNA Translation: AAB50207.1
CCDSiCCDS74886.1 [Q13387-1]
RefSeqiNP_036456.1, NM_012324.4 [Q13387-1]

3D structure databases

SMRiQ13387
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi117086, 95 interactors
CORUMiQ13387
IntActiQ13387, 84 interactors
MINTiQ13387
STRINGi9606.ENSP00000330572

Protein family/group databases

MoonDBiQ13387, Predicted

PTM databases

iPTMnetiQ13387
PhosphoSitePlusiQ13387

Genetic variation databases

BioMutaiMAPK8IP2
DMDMi17433017

Proteomic databases

MassIVEiQ13387
PaxDbiQ13387
PeptideAtlasiQ13387
PRIDEiQ13387
ProteomicsDBi59356 [Q13387-1]
59357 [Q13387-2]
59358 [Q13387-3]
59359 [Q13387-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		28835, 243 antibodies

The DNASU plasmid repository

More...DNASUi		23542

Genome annotation databases

EnsembliENST00000329492; ENSP00000330572; ENSG00000008735 [Q13387-1]
GeneIDi23542
KEGGihsa:23542
UCSCiuc032qrw.2, human [Q13387-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23542
DisGeNETi23542

GeneCards: human genes, protein and diseases

More...GeneCardsi		MAPK8IP2
HGNCiHGNC:6883, MAPK8IP2
HPAiENSG00000008735, Tissue enriched (brain)
MIMi607755, gene
neXtProtiNX_Q13387
OpenTargetsiENSG00000008735
PharmGKBiPA30627
VEuPathDBiHostDB:ENSG00000008735.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3775, Eukaryota
GeneTreeiENSGT00940000160461
HOGENOMiCLU_006711_0_0_1
InParanoidiQ13387
OMAiCEGNRPA
OrthoDBi372907at2759
PhylomeDBiQ13387

Enzyme and pathway databases

PathwayCommonsiQ13387
SignaLinkiQ13387
SIGNORiQ13387

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23542, 3 hits in 207 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MAPK8IP2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MAPK8IP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23542
PharosiQ13387, Tbio

Protein Ontology

More...PROi		PR:Q13387
RNActiQ13387, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000008735, Expressed in anterior cingulate cortex and 195 other tissues
GenevisibleiQ13387, HS

Family and domain databases

CDDicd11942, SH3_JIP2, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035637, JIP2_SH3
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR001452, SH3_domain
PfamiView protein in Pfam
PF00640, PID, 1 hit
PF14604, SH3_9, 1 hit
SMARTiView protein in SMART
SM00462, PTB, 1 hit
SM00326, SH3, 1 hit
PROSITEiView protein in PROSITE
PS01179, PID, 1 hit
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiJIP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13387
Secondary accession number(s): Q96G62
, Q99771, Q9NZ59, Q9UKQ4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: December 5, 2001
Last modified: April 7, 2021
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again