Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein R

Gene

ITGB3BP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein C-terminus binding Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Repressor
Biological processApoptosis, Cell cycle, Cell division, Mitosis, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-205043 NRIF signals cell death from the nucleus
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-68877 Mitotic Prometaphase

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13352

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centromere protein R
Short name:
CENP-R
Alternative name(s):
Beta-3-endonexin
Integrin beta-3-binding protein
Nuclear receptor-interacting factor 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ITGB3BP
Synonyms:CENPR, NRIF3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000142856.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6157 ITGB3BP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605494 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13352

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Kinetochore, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi9L → A: Decreased interaction with nuclear receptors. 1 Publication1
Mutagenesisi28S → A: Loss of repressor function. 2 Publications1
Mutagenesisi63 – 66Missing : Abolishes localization to nucleus. 1 Publication4
Mutagenesisi63 – 65KRK → AAA: Abolishes localization to nucleus. 1 Publication3
Mutagenesisi89L → R: Abolishes dimerization, but not interactions with nuclear receptors; when associated with R-96. 1 Publication1
Mutagenesisi96L → R: Abolishes dimerization, but not interactions with nuclear receptors; when associated with R-89. 1 Publication1
Mutagenesisi172 – 176LKAIL → AKAAA: Abolishes interaction with nuclear receptors. 1 Publication5

Organism-specific databases

DisGeNET

More...
DisGeNETi
23421

Open Targets

More...
OpenTargetsi
ENSG00000142856

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29956

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ITGB3BP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50400855

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000579491 – 177Centromere protein RAdd BLAST177

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki8Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei17PhosphoserineCombined sources1
Cross-linki22Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei28Phosphoserine1 Publication1
Modified residuei71PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13352

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13352

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13352

PeptideAtlas

More...
PeptideAtlasi
Q13352

PRoteomics IDEntifications database

More...
PRIDEi
Q13352

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59336
59337 [Q13352-2]
59338 [Q13352-3]
59339 [Q13352-4]
59340 [Q13352-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q13352-1 [Q13352-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13352

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13352

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in spleen, thymus, prostate, ovary, small intestine and white blood cells. Highly expressed in testis and colon. Isoform 4 is expressed in platelets, lymphocytes and granulocytes.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By estrogen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000142856 Expressed in 216 organ(s), highest expression level in oocyte

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13352 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028463

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; mediated by the coiled coil domain. Isoform 3, but not other isoforms, interacts with the cytoplasmic tail of integrin ITGB3. The relevance of the interaction with ITGB3 is however uncertain, since isoform 3 is mainly nuclear. Interacts with CCNA2 and MTA1. Interacts with NFKB1 NF-kappa-B subunit. Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU.7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116992, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q13352

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q13352

Protein interaction database and analysis system

More...
IntActi
Q13352, 71 interactors

Molecular INTeraction database

More...
MINTi
Q13352

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360133

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q13352

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni20 – 50DD1Add BLAST31

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili83 – 113Sequence analysisAdd BLAST31

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi9 – 13LXXLL motif5
Motifi63 – 66Nuclear localization signal4
Motifi172 – 176LXXIL motif5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DD1 domain (also called RepD1 domain) mediates the corepressor function and is essential in the triggering of apoptosis.1 Publication
Contains one Leu-Xaa-Xaa-Leu-Leu (LXXLL) motif, a motif known to be important for the association with nuclear receptors. Such motif, which is required for an efficient association with nuclear receptors, is however not essential.1 Publication
Contains one Leu-Xaa-Xaa-Ile-Leu (LXXIL) motif, which is essential for the association with nuclear receptors.1 Publication

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J05S Eukaryota
ENOG410Z43R LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004336

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080553

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13352

KEGG Orthology (KO)

More...
KOi
K11510

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHLDSYE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G180Q

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13352

TreeFam database of animal gene trees

More...
TreeFami
TF336291

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009601 CENP-R

The PANTHER Classification System

More...
PANTHERi
PTHR15581 PTHR15581, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06729 CENP-R, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF011860 NRIF3_coact_rcpt, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q13352-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVKRSLKLD GLLEENSFDP SKITRKKSVI TYSPTTGTCQ MSLFASPTSS
60 70 80 90 100
EEQKHRNGLS NEKRKKLNHP SLTESKESTT KDNDEFMMLL SKVEKLSEEI
110 120 130 140 150
MEIMQNLSSI QALEGSRELE NLIGISCASH FLKREMQKTK ELMTKVNKQK
160 170
LFEKSTGLPH KASRHLDSYE FLKAILN
Length:177
Mass (Da):20,194
Last modified:July 19, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC0A6FD5A56E98D43
GO
Isoform 2 (identifier: Q13352-2) [UniParc]FASTAAdd to basket
Also known as: Long, EnL, En-L

The sequence of this isoform differs from the canonical sequence as follows:
     162-177: ASRHLDSYEFLKAILN → GQPQMSQPL

Show »
Length:170
Mass (Da):19,302
Checksum:i227EE95365D0AB5C
GO
Isoform 3 (identifier: Q13352-3) [UniParc]FASTAAdd to basket
Also known as: Short, EnS, En-S

The sequence of this isoform differs from the canonical sequence as follows:
     112-177: Missing.

Show »
Length:111
Mass (Da):12,624
Checksum:i790E4D07D5CC09AF
GO
Isoform 4 (identifier: Q13352-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-177: Missing.

Show »
Length:62
Mass (Da):6,902
Checksum:iDB8074B62E359160
GO
Isoform 5 (identifier: Q13352-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MP → MPFAPVAQARVQWHDFRSLQHLLPAFKRFSCLSLGSSWDYS

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):24,729
Checksum:i1D131D450750DCF4
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH14385 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04869130I → V. Corresponds to variant dbSNP:rs1058057Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0108311 – 2MP → MPFAPVAQARVQWHDFRSLQ HLLPAFKRFSCLSLGSSWDY S in isoform 5. 1 Publication2
Alternative sequenceiVSP_01083263 – 177Missing in isoform 4. CuratedAdd BLAST115
Alternative sequenceiVSP_010833112 – 177Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_010834162 – 177ASRHL…KAILN → GQPQMSQPL in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U37139 mRNA Translation: AAC50295.1
U37139 mRNA Translation: AAC50294.1
AF175306 mRNA Translation: AAF00239.1
AK312944 mRNA Translation: BAG35785.1
BX004807, AL592218 Genomic DNA Translation: CAI15771.1
BX004807, AL592218 Genomic DNA Translation: CAI15772.1
AL592218, BX004807 Genomic DNA Translation: CAI18958.1
AL592218, BX004807 Genomic DNA Translation: CAI18959.1
BC009929 mRNA Translation: AAH09929.1
BC014385 mRNA Translation: AAH14385.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30736.1 [Q13352-1]
CCDS55603.1 [Q13352-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57277

NCBI Reference Sequences

More...
RefSeqi
NP_001193668.1, NM_001206739.1 [Q13352-5]
NP_001334077.1, NM_001347148.1
NP_055103.3, NM_014288.4 [Q13352-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.166539

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000271002; ENSP00000271002; ENSG00000142856 [Q13352-1]
ENST00000371092; ENSP00000360133; ENSG00000142856 [Q13352-5]
ENST00000489099; ENSP00000432904; ENSG00000142856 [Q13352-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23421

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23421

UCSC genome browser

More...
UCSCi
uc001dba.3 human [Q13352-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37139 mRNA Translation: AAC50295.1
U37139 mRNA Translation: AAC50294.1
AF175306 mRNA Translation: AAF00239.1
AK312944 mRNA Translation: BAG35785.1
BX004807, AL592218 Genomic DNA Translation: CAI15771.1
BX004807, AL592218 Genomic DNA Translation: CAI15772.1
AL592218, BX004807 Genomic DNA Translation: CAI18958.1
AL592218, BX004807 Genomic DNA Translation: CAI18959.1
BC009929 mRNA Translation: AAH09929.1
BC014385 mRNA Translation: AAH14385.1 Different initiation.
CCDSiCCDS30736.1 [Q13352-1]
CCDS55603.1 [Q13352-5]
PIRiA57277
RefSeqiNP_001193668.1, NM_001206739.1 [Q13352-5]
NP_001334077.1, NM_001347148.1
NP_055103.3, NM_014288.4 [Q13352-1]
UniGeneiHs.166539

3D structure databases

ProteinModelPortaliQ13352
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116992, 46 interactors
CORUMiQ13352
ELMiQ13352
IntActiQ13352, 71 interactors
MINTiQ13352
STRINGi9606.ENSP00000360133

PTM databases

iPTMnetiQ13352
PhosphoSitePlusiQ13352

Polymorphism and mutation databases

BioMutaiITGB3BP
DMDMi50400855

Proteomic databases

EPDiQ13352
MaxQBiQ13352
PaxDbiQ13352
PeptideAtlasiQ13352
PRIDEiQ13352
ProteomicsDBi59336
59337 [Q13352-2]
59338 [Q13352-3]
59339 [Q13352-4]
59340 [Q13352-5]
TopDownProteomicsiQ13352-1 [Q13352-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23421
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000271002; ENSP00000271002; ENSG00000142856 [Q13352-1]
ENST00000371092; ENSP00000360133; ENSG00000142856 [Q13352-5]
ENST00000489099; ENSP00000432904; ENSG00000142856 [Q13352-2]
GeneIDi23421
KEGGihsa:23421
UCSCiuc001dba.3 human [Q13352-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23421
DisGeNETi23421
EuPathDBiHostDB:ENSG00000142856.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ITGB3BP

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0019635
HGNCiHGNC:6157 ITGB3BP
HPAiHPA028463
MIMi605494 gene
neXtProtiNX_Q13352
OpenTargetsiENSG00000142856
PharmGKBiPA29956

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J05S Eukaryota
ENOG410Z43R LUCA
GeneTreeiENSGT00390000004336
HOVERGENiHBG080553
InParanoidiQ13352
KOiK11510
OMAiCHLDSYE
OrthoDBiEOG091G180Q
PhylomeDBiQ13352
TreeFamiTF336291

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-205043 NRIF signals cell death from the nucleus
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-68877 Mitotic Prometaphase
SIGNORiQ13352

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ITGB3BP human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ITGB3BP

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23421

Protein Ontology

More...
PROi
PR:Q13352

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000142856 Expressed in 216 organ(s), highest expression level in oocyte
GenevisibleiQ13352 HS

Family and domain databases

InterProiView protein in InterPro
IPR009601 CENP-R
PANTHERiPTHR15581 PTHR15581, 1 hit
PfamiView protein in Pfam
PF06729 CENP-R, 1 hit
PIRSFiPIRSF011860 NRIF3_coact_rcpt, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCENPR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13352
Secondary accession number(s): B2R7D8
, Q13353, Q5RJ42, Q5RJ44, Q5RJ45, Q7KYX2, Q96CD5, Q9UKB6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: December 5, 2018
This is version 150 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again