Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear body protein SP140

Gene

SP140

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body (PubMed:8910577). May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection (PubMed:8910577). May play a role in chromatin-mediated regulation of gene expression although it does not bind to histone H3 tails (PubMed:24267382).1 Publication2 Publications

Miscellaneous

This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri690 – 736PHD-typePROSITE-ProRule annotationAdd BLAST47

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • DNA-binding transcription factor activity Source: ProtInc
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear body protein SP140Imported
Alternative name(s):
Lymphoid-restricted homolog of Sp1001 Publication
Short name:
LYSp1001 Publication
Nuclear autoantigen Sp-1401 Publication
Speckled 140 kDa1 Publication
Gene namesi
Name:SP140Imported
Synonyms:LYSP1001 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000079263.18
HGNCiHGNC:17133 SP140
MIMi608602 gene
neXtProtiNX_Q13342

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi11262
OpenTargetsiENSG00000079263
PharmGKBiPA38205

Chemistry databases

ChEMBLiCHEMBL3108643

Polymorphism and mutation databases

BioMutaiSP140
DMDMi218511671

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002112061 – 867Nuclear body protein SP140Add BLAST867

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei726Phosphothreonine1 Publication1

Post-translational modificationi

Phosphorylation at Thr-726 promotes binding of PIN1 and subsequent isomerization of Pro-727.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ13342
MaxQBiQ13342
PaxDbiQ13342
PeptideAtlasiQ13342
PRIDEiQ13342
ProteomicsDBi59329
59330 [Q13342-2]
59331 [Q13342-3]
59332 [Q13342-4]

PTM databases

iPTMnetiQ13342
PhosphoSitePlusiQ13342

Expressioni

Tissue specificityi

High levels in spleen and peripheral blood leukocytes, much lower levels in tonsils, thymus, prostate, ovary, small intestine, and colon (PubMed:8695863, PubMed:8910577.) Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas (PubMed:8910577). Not detected in brain, liver and muscle (PubMed:8695863).2 Publications

Inductioni

By gamma-interferon.1 Publication

Gene expression databases

BgeeiENSG00000079263 Expressed in 122 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_SP140
ExpressionAtlasiQ13342 baseline and differential
GenevisibleiQ13342 HS

Organism-specific databases

HPAiHPA006162
HPA067493

Interactioni

Subunit structurei

Interacts with PIN1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PIN1Q135264EBI-2865100,EBI-714158

Protein-protein interaction databases

BioGridi116422, 1 interactor
IntActiQ13342, 3 interactors
MINTiQ13342
STRINGi9606.ENSP00000375899

Structurei

Secondary structure

1867
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ13342
SMRiQ13342
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 138HSRPROSITE-ProRule annotationAdd BLAST117
Domaini580 – 661SANDPROSITE-ProRule annotationAdd BLAST82
Domaini796 – 829BromoPROSITE-ProRule annotationAdd BLAST34

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi495 – 514Nuclear localization signalSequence analysisAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi784 – 787Poly-Tyr4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri690 – 736PHD-typePROSITE-ProRule annotationAdd BLAST47

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

eggNOGiKOG2177 Eukaryota
ENOG4111G04 LUCA
GeneTreeiENSGT00510000046835
HOGENOMiHOG000089984
HOVERGENiHBG006294
InParanoidiQ13342
OMAiAYENEKC
OrthoDBiEOG091G01MN
PhylomeDBiQ13342
TreeFamiTF335091

Family and domain databases

Gene3Di1.20.920.10, 1 hit
3.10.390.10, 1 hit
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR004865 HSR_dom
IPR010919 SAND-like_dom_sf
IPR000770 SAND_dom
IPR030411 SP140
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
PANTHERiPTHR13711:SF231 PTHR13711:SF231, 1 hit
PfamiView protein in Pfam
PF00439 Bromodomain, 1 hit
PF03172 HSR, 1 hit
PF01342 SAND, 1 hit
SMARTiView protein in SMART
SM00297 BROMO, 1 hit
SM00249 PHD, 1 hit
SM00258 SAND, 1 hit
SUPFAMiSSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit
SSF63763 SSF63763, 1 hit
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS51414 HSR, 1 hit
PS50864 SAND, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform LYSp100-B1 Publication (identifier: Q13342-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQQGQQGQM ASGDSNLNFR MVAEIQNVEG QNLQEQVCPE PIFRFFRENK
60 70 80 90 100
VEIASAITRP FPFLMGLRDR SFISEQMYEH FQEAFRNLVP VTRVMYCVLS
110 120 130 140 150
ELEKTFGWSH LEALFSRINL MAYPDLNEIY RSFQNVCYEH SPLQMNNVND
160 170 180 190 200
LEDRPRLLPY GKQENSNACH EMDDIAVPQE ALSSSPRCEP GFSSESCEQL
210 220 230 240 250
ALPKAGGGDA EDAPSLLPGG GVSCKLAIQI DEGESEEMPK LLPYDTEVLE
260 270 280 290 300
SNGMIDAART YSTAPGEKQG EEEGRNSPRK RNQDKEKYQE SPEGRDKETF
310 320 330 340 350
DLKTPQVTNE GEPEKGLCLL PGEGEEGSDD CSEMCDGEEP QEASSSLARC
360 370 380 390 400
GSVSCLSAET FDLKTPQVTN EGEPEKELSL LPGEGEEGSD DCSEMCDGEE
410 420 430 440 450
RQEASSSLAR RGSVSSELEN HPMNEEGESE ELASSLLYDN VPGAEQSAYE
460 470 480 490 500
NEKCSCVMCF SEEVPGSPEA RTESDQACGT MDTVDIANNS TLGKPKRKRR
510 520 530 540 550
KKRGHGWSRM RMRRQENSQQ NDNSKADGQV VSSEKKANVN LKDLSKIRGR
560 570 580 590 600
KRGKPGTRFT QSDRAAQKRV RSRASRKHKD ETVDFKAPLL PVTCGGVKGI
610 620 630 640 650
LHKKKLQQGI LVKCIQTEDG KWFTPTEFEI KGGHARSKNW RLSVRCGGWP
660 670 680 690 700
LRWLMENGFL PDPPRIRYRK KKRILKSQNN SSVDPCMRNL DECEVCRDGG
710 720 730 740 750
ELFCCDTCSR VFHEDCHIPP VEAERTPWNC IFCRMKESPG SQQCCQESEV
760 770 780 790 800
LERQMCPEEQ LKCEFLLLKV YCCSESSFFA KIPYYYYIRE ACQGLKEPMW
810 820 830 840 850
LDKIKKRLNE HGYPQVEGFV QDMRLIFQNH RASYKYKDFG QMGFRLEAEF
860
EKNFKEVFAI QETNGNN
Length:867
Mass (Da):98,223
Last modified:December 16, 2008 - v2
Checksum:i355601D1D4689A74
GO
Isoform LYSp100-A1 Publication (identifier: Q13342-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: Missing.
     405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE
     447-867: Missing.

Show »
Length:412
Mass (Da):46,151
Checksum:i093D90128FEBE1EE
GO
Isoform Sp1401 Publication (identifier: Q13342-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-221: Missing.
     248-297: Missing.
     326-386: Missing.

Show »
Length:753
Mass (Da):86,010
Checksum:iEAA28FD5FCA8056A
GO
Isoform 4 (identifier: Q13342-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
     173-867: Missing.

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):19,965
Checksum:i653BE8A523DFF473
GO
Isoform 5 (identifier: Q13342-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-413: Missing.

Note: No experimental confirmation available.
Show »
Length:840
Mass (Da):95,349
Checksum:i7221064EAA37283D
GO
Isoform 6 (identifier: Q13342-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-247: Missing.
     353-386: Missing.

Note: No experimental confirmation available.
Show »
Length:807
Mass (Da):91,673
Checksum:i7203F0807D7373B3
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
U3KPV9U3KPV9_HUMAN
Nuclear body protein SP140
SP140
29Annotation score:

Sequence cautioni

The sequence AAB18617 differs from that shown. Reason: Frameshift at position 862.Curated
The sequence AAX93282 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti186P → A in AAB18616 (PubMed:8695863).Curated1
Sequence conflicti186P → A in AAB18617 (PubMed:8695863).Curated1
Sequence conflicti186P → A in AAC50817 (PubMed:8910577).Curated1
Sequence conflicti356 – 358LSA → FST in AAB18617 (PubMed:8695863).Curated3
Sequence conflicti457V → D in AAI05744 (PubMed:15489334).Curated1
Sequence conflicti838D → G in AAB18617 (PubMed:8695863).Curated1
Sequence conflicti862E → G in AAB18617 (PubMed:8695863).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055555356L → F. Corresponds to variant dbSNP:rs3820975Ensembl.1
Natural variantiVAR_055556512M → T. Corresponds to variant dbSNP:rs4972945Ensembl.1
Natural variantiVAR_055557516E → K2 PublicationsCorresponds to variant dbSNP:rs4972946Ensembl.1
Natural variantiVAR_055558558R → C. Corresponds to variant dbSNP:rs11887179Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043235136 – 172VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_043236173 – 867Missing in isoform 4. 1 PublicationAdd BLAST695
Alternative sequenceiVSP_055922219 – 221Missing in isoform Sp140. 1 Publication3
Alternative sequenceiVSP_055923222 – 247Missing in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_000558248 – 297Missing in isoform Sp140. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_000559326 – 386Missing in isoform Sp140. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_000560353 – 386Missing in isoform LYSp100-A and isoform 6. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_055924387 – 413Missing in isoform 5. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_000561405 – 446SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_000562447 – 867Missing in isoform LYSp100-A. 1 PublicationAdd BLAST421

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA Translation: AAB18616.1
U36500 mRNA Translation: AAB18617.1 Frameshift.
U63420 mRNA Translation: AAC50817.1
AC009949 Genomic DNA Translation: AAX88868.1
AC009950 Genomic DNA Translation: AAX93282.1 Sequence problems.
CH471063 Genomic DNA Translation: EAW70922.1
BC105743 mRNA Translation: AAI05744.1
BC105960 mRNA Translation: AAI05961.1
BC070160 mRNA Translation: AAH70160.1
CCDSiCCDS33392.1 [Q13342-4]
CCDS42831.1 [Q13342-1]
CCDS63149.1 [Q13342-3]
CCDS63150.1 [Q13342-5]
CCDS63151.1 [Q13342-6]
PIRiG02099
RefSeqiNP_001005176.1, NM_001005176.2 [Q13342-4]
NP_001265380.1, NM_001278451.1 [Q13342-5]
NP_001265381.1, NM_001278452.1 [Q13342-6]
NP_001265382.1, NM_001278453.1 [Q13342-3]
NP_009168.4, NM_007237.4 [Q13342-1]
UniGeneiHs.632549

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263 [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263 [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263 [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263 [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263 [Q13342-5]
GeneIDi11262
KEGGihsa:11262
UCSCiuc002vqj.4 human [Q13342-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA Translation: AAB18616.1
U36500 mRNA Translation: AAB18617.1 Frameshift.
U63420 mRNA Translation: AAC50817.1
AC009949 Genomic DNA Translation: AAX88868.1
AC009950 Genomic DNA Translation: AAX93282.1 Sequence problems.
CH471063 Genomic DNA Translation: EAW70922.1
BC105743 mRNA Translation: AAI05744.1
BC105960 mRNA Translation: AAI05961.1
BC070160 mRNA Translation: AAH70160.1
CCDSiCCDS33392.1 [Q13342-4]
CCDS42831.1 [Q13342-1]
CCDS63149.1 [Q13342-3]
CCDS63150.1 [Q13342-5]
CCDS63151.1 [Q13342-6]
PIRiG02099
RefSeqiNP_001005176.1, NM_001005176.2 [Q13342-4]
NP_001265380.1, NM_001278451.1 [Q13342-5]
NP_001265381.1, NM_001278452.1 [Q13342-6]
NP_001265382.1, NM_001278453.1 [Q13342-3]
NP_009168.4, NM_007237.4 [Q13342-1]
UniGeneiHs.632549

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
6G8RX-ray2.74B687-862[»]
ProteinModelPortaliQ13342
SMRiQ13342
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116422, 1 interactor
IntActiQ13342, 3 interactors
MINTiQ13342
STRINGi9606.ENSP00000375899

Chemistry databases

ChEMBLiCHEMBL3108643

PTM databases

iPTMnetiQ13342
PhosphoSitePlusiQ13342

Polymorphism and mutation databases

BioMutaiSP140
DMDMi218511671

Proteomic databases

EPDiQ13342
MaxQBiQ13342
PaxDbiQ13342
PeptideAtlasiQ13342
PRIDEiQ13342
ProteomicsDBi59329
59330 [Q13342-2]
59331 [Q13342-3]
59332 [Q13342-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263 [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263 [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263 [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263 [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263 [Q13342-5]
GeneIDi11262
KEGGihsa:11262
UCSCiuc002vqj.4 human [Q13342-1]

Organism-specific databases

CTDi11262
DisGeNETi11262
EuPathDBiHostDB:ENSG00000079263.18
GeneCardsiSP140
HGNCiHGNC:17133 SP140
HPAiHPA006162
HPA067493
MIMi608602 gene
neXtProtiNX_Q13342
OpenTargetsiENSG00000079263
PharmGKBiPA38205
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2177 Eukaryota
ENOG4111G04 LUCA
GeneTreeiENSGT00510000046835
HOGENOMiHOG000089984
HOVERGENiHBG006294
InParanoidiQ13342
OMAiAYENEKC
OrthoDBiEOG091G01MN
PhylomeDBiQ13342
TreeFamiTF335091

Miscellaneous databases

ChiTaRSiSP140 human
GenomeRNAii11262
PROiPR:Q13342
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079263 Expressed in 122 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_SP140
ExpressionAtlasiQ13342 baseline and differential
GenevisibleiQ13342 HS

Family and domain databases

Gene3Di1.20.920.10, 1 hit
3.10.390.10, 1 hit
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR004865 HSR_dom
IPR010919 SAND-like_dom_sf
IPR000770 SAND_dom
IPR030411 SP140
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
PANTHERiPTHR13711:SF231 PTHR13711:SF231, 1 hit
PfamiView protein in Pfam
PF00439 Bromodomain, 1 hit
PF03172 HSR, 1 hit
PF01342 SAND, 1 hit
SMARTiView protein in SMART
SM00297 BROMO, 1 hit
SM00249 PHD, 1 hit
SM00258 SAND, 1 hit
SUPFAMiSSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit
SSF63763 SSF63763, 1 hit
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS51414 HSR, 1 hit
PS50864 SAND, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSP140_HUMAN
AccessioniPrimary (citable) accession number: Q13342
Secondary accession number(s): E7ESH9
, E7EUR5, E9PFJ6, Q0VGE5, Q13341, Q3KR17, Q4ZG66, Q53TG1, Q6NSG4, Q92881, Q96TG3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 16, 2008
Last modified: November 7, 2018
This is version 167 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again