Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (16 Oct 2019)
Sequence version 2 (16 Dec 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear body protein SP140

Gene

SP140

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body (PubMed:8910577). May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection (PubMed:8910577). May play a role in chromatin-mediated regulation of gene expression although it does not bind to histone H3 tails (PubMed:24267382).1 Publication2 Publications

Miscellaneous

This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri690 – 736PHD-typePROSITE-ProRule annotationAdd BLAST47

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • DNA-binding transcription factor activity Source: ProtInc
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear body protein SP140Imported
Alternative name(s):
Lymphoid-restricted homolog of Sp1001 Publication
Short name:
LYSp1001 Publication
Nuclear autoantigen Sp-1401 Publication
Speckled 140 kDa1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SP140Imported
Synonyms:LYSP1001 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17133 SP140

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608602 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13342

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
11262

Open Targets

More...
OpenTargetsi
ENSG00000079263

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38205

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q13342

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3108643

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SP140

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218511671

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002112061 – 867Nuclear body protein SP140Add BLAST867

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei726Phosphothreonine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Thr-726 promotes binding of PIN1 and subsequent isomerization of Pro-727.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13342

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13342

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q13342

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13342

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13342

PeptideAtlas

More...
PeptideAtlasi
Q13342

PRoteomics IDEntifications database

More...
PRIDEi
Q13342

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17997
18479
20120
59329 [Q13342-1]
59330 [Q13342-2]
59331 [Q13342-3]
59332 [Q13342-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13342

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13342

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High levels in spleen and peripheral blood leukocytes, much lower levels in tonsils, thymus, prostate, ovary, small intestine, and colon (PubMed:8695863, PubMed:8910577.) Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas (PubMed:8910577). Not detected in brain, liver and muscle (PubMed:8695863).2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By gamma-interferon.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000079263 Expressed in 122 organ(s), highest expression level in small intestine Peyer's patch

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13342 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13342 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006162
HPA067493

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PIN1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q135264EBI-2865100,EBI-714158

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116422, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q13342, 6 interactors

Molecular INTeraction database

More...
MINTi
Q13342

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000375899

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1867
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13342

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 138HSRPROSITE-ProRule annotationAdd BLAST117
Domaini580 – 661SANDPROSITE-ProRule annotationAdd BLAST82
Domaini796 – 829BromoPROSITE-ProRule annotationAdd BLAST34

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi495 – 514Nuclear localization signalSequence analysisAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi784 – 787Poly-Tyr4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri690 – 736PHD-typePROSITE-ProRule annotationAdd BLAST47

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2177 Eukaryota
ENOG4111G04 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162129

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000089984

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13342

Identification of Orthologs from Complete Genome Data

More...
OMAi
NPPRKYF

Database of Orthologous Groups

More...
OrthoDBi
377499at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13342

TreeFam database of animal gene trees

More...
TreeFami
TF335091

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.920.10, 1 hit
3.10.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR004865 HSR_dom
IPR010919 SAND-like_dom_sf
IPR000770 SAND_dom
IPR030411 SP140
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger

The PANTHER Classification System

More...
PANTHERi
PTHR46386:SF2 PTHR46386:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00439 Bromodomain, 1 hit
PF03172 HSR, 1 hit
PF01342 SAND, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00297 BROMO, 1 hit
SM00249 PHD, 1 hit
SM00258 SAND, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit
SSF63763 SSF63763, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS51414 HSR, 1 hit
PS50864 SAND, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform LYSp100-B1 Publication (identifier: Q13342-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQQGQQGQM ASGDSNLNFR MVAEIQNVEG QNLQEQVCPE PIFRFFRENK
60 70 80 90 100
VEIASAITRP FPFLMGLRDR SFISEQMYEH FQEAFRNLVP VTRVMYCVLS
110 120 130 140 150
ELEKTFGWSH LEALFSRINL MAYPDLNEIY RSFQNVCYEH SPLQMNNVND
160 170 180 190 200
LEDRPRLLPY GKQENSNACH EMDDIAVPQE ALSSSPRCEP GFSSESCEQL
210 220 230 240 250
ALPKAGGGDA EDAPSLLPGG GVSCKLAIQI DEGESEEMPK LLPYDTEVLE
260 270 280 290 300
SNGMIDAART YSTAPGEKQG EEEGRNSPRK RNQDKEKYQE SPEGRDKETF
310 320 330 340 350
DLKTPQVTNE GEPEKGLCLL PGEGEEGSDD CSEMCDGEEP QEASSSLARC
360 370 380 390 400
GSVSCLSAET FDLKTPQVTN EGEPEKELSL LPGEGEEGSD DCSEMCDGEE
410 420 430 440 450
RQEASSSLAR RGSVSSELEN HPMNEEGESE ELASSLLYDN VPGAEQSAYE
460 470 480 490 500
NEKCSCVMCF SEEVPGSPEA RTESDQACGT MDTVDIANNS TLGKPKRKRR
510 520 530 540 550
KKRGHGWSRM RMRRQENSQQ NDNSKADGQV VSSEKKANVN LKDLSKIRGR
560 570 580 590 600
KRGKPGTRFT QSDRAAQKRV RSRASRKHKD ETVDFKAPLL PVTCGGVKGI
610 620 630 640 650
LHKKKLQQGI LVKCIQTEDG KWFTPTEFEI KGGHARSKNW RLSVRCGGWP
660 670 680 690 700
LRWLMENGFL PDPPRIRYRK KKRILKSQNN SSVDPCMRNL DECEVCRDGG
710 720 730 740 750
ELFCCDTCSR VFHEDCHIPP VEAERTPWNC IFCRMKESPG SQQCCQESEV
760 770 780 790 800
LERQMCPEEQ LKCEFLLLKV YCCSESSFFA KIPYYYYIRE ACQGLKEPMW
810 820 830 840 850
LDKIKKRLNE HGYPQVEGFV QDMRLIFQNH RASYKYKDFG QMGFRLEAEF
860
EKNFKEVFAI QETNGNN
Length:867
Mass (Da):98,223
Last modified:December 16, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i355601D1D4689A74
GO
Isoform LYSp100-A1 Publication (identifier: Q13342-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: Missing.
     405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE
     447-867: Missing.

Show »
Length:412
Mass (Da):46,151
Checksum:i093D90128FEBE1EE
GO
Isoform Sp1401 Publication (identifier: Q13342-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-221: Missing.
     248-297: Missing.
     326-386: Missing.

Show »
Length:753
Mass (Da):86,010
Checksum:iEAA28FD5FCA8056A
GO
Isoform 4 (identifier: Q13342-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
     173-867: Missing.

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):19,965
Checksum:i653BE8A523DFF473
GO
Isoform 5 (identifier: Q13342-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-413: Missing.

Note: No experimental confirmation available.
Show »
Length:840
Mass (Da):95,349
Checksum:i7221064EAA37283D
GO
Isoform 6 (identifier: Q13342-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-247: Missing.
     353-386: Missing.

Note: No experimental confirmation available.
Show »
Length:807
Mass (Da):91,673
Checksum:i7203F0807D7373B3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
U3KPV9U3KPV9_HUMAN
Nuclear body protein SP140
SP140
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB18617 differs from that shown. Reason: Frameshift.Curated
The sequence AAX93282 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti186P → A in AAB18616 (PubMed:8695863).Curated1
Sequence conflicti186P → A in AAB18617 (PubMed:8695863).Curated1
Sequence conflicti186P → A in AAC50817 (PubMed:8910577).Curated1
Sequence conflicti356 – 358LSA → FST in AAB18617 (PubMed:8695863).Curated3
Sequence conflicti457V → D in AAI05744 (PubMed:15489334).Curated1
Sequence conflicti838D → G in AAB18617 (PubMed:8695863).Curated1
Sequence conflicti862E → G in AAB18617 (PubMed:8695863).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055555356L → F. Corresponds to variant dbSNP:rs3820975Ensembl.1
Natural variantiVAR_055556512M → T. Corresponds to variant dbSNP:rs4972945Ensembl.1
Natural variantiVAR_055557516E → K2 PublicationsCorresponds to variant dbSNP:rs4972946Ensembl.1
Natural variantiVAR_055558558R → C. Corresponds to variant dbSNP:rs11887179Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043235136 – 172VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_043236173 – 867Missing in isoform 4. 1 PublicationAdd BLAST695
Alternative sequenceiVSP_055922219 – 221Missing in isoform Sp140. 1 Publication3
Alternative sequenceiVSP_055923222 – 247Missing in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_000558248 – 297Missing in isoform Sp140. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_000559326 – 386Missing in isoform Sp140. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_000560353 – 386Missing in isoform LYSp100-A and isoform 6. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_055924387 – 413Missing in isoform 5. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_000561405 – 446SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_000562447 – 867Missing in isoform LYSp100-A. 1 PublicationAdd BLAST421

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U36499 mRNA Translation: AAB18616.1
U36500 mRNA Translation: AAB18617.1 Frameshift.
U63420 mRNA Translation: AAC50817.1
AC009949 Genomic DNA Translation: AAX88868.1
AC009950 Genomic DNA Translation: AAX93282.1 Sequence problems.
CH471063 Genomic DNA Translation: EAW70922.1
BC105743 mRNA Translation: AAI05744.1
BC105960 mRNA Translation: AAI05961.1
BC070160 mRNA Translation: AAH70160.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33392.1 [Q13342-4]
CCDS42831.1 [Q13342-1]
CCDS63149.1 [Q13342-3]
CCDS63150.1 [Q13342-5]
CCDS63151.1 [Q13342-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02099

NCBI Reference Sequences

More...
RefSeqi
NP_001005176.1, NM_001005176.2 [Q13342-4]
NP_001265380.1, NM_001278451.1 [Q13342-5]
NP_001265381.1, NM_001278452.1 [Q13342-6]
NP_001265382.1, NM_001278453.1 [Q13342-3]
NP_009168.4, NM_007237.4 [Q13342-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343805; ENSP00000342096; ENSG00000079263 [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263 [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263 [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263 [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263 [Q13342-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11262

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11262

UCSC genome browser

More...
UCSCi
uc002vqj.4 human [Q13342-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA Translation: AAB18616.1
U36500 mRNA Translation: AAB18617.1 Frameshift.
U63420 mRNA Translation: AAC50817.1
AC009949 Genomic DNA Translation: AAX88868.1
AC009950 Genomic DNA Translation: AAX93282.1 Sequence problems.
CH471063 Genomic DNA Translation: EAW70922.1
BC105743 mRNA Translation: AAI05744.1
BC105960 mRNA Translation: AAI05961.1
BC070160 mRNA Translation: AAH70160.1
CCDSiCCDS33392.1 [Q13342-4]
CCDS42831.1 [Q13342-1]
CCDS63149.1 [Q13342-3]
CCDS63150.1 [Q13342-5]
CCDS63151.1 [Q13342-6]
PIRiG02099
RefSeqiNP_001005176.1, NM_001005176.2 [Q13342-4]
NP_001265380.1, NM_001278451.1 [Q13342-5]
NP_001265381.1, NM_001278452.1 [Q13342-6]
NP_001265382.1, NM_001278453.1 [Q13342-3]
NP_009168.4, NM_007237.4 [Q13342-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
6G8RX-ray2.74B687-862[»]
SMRiQ13342
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi116422, 1 interactor
IntActiQ13342, 6 interactors
MINTiQ13342
STRINGi9606.ENSP00000375899

Chemistry databases

ChEMBLiCHEMBL3108643

PTM databases

iPTMnetiQ13342
PhosphoSitePlusiQ13342

Polymorphism and mutation databases

BioMutaiSP140
DMDMi218511671

Proteomic databases

EPDiQ13342
jPOSTiQ13342
MassIVEiQ13342
MaxQBiQ13342
PaxDbiQ13342
PeptideAtlasiQ13342
PRIDEiQ13342
ProteomicsDBi17997
18479
20120
59329 [Q13342-1]
59330 [Q13342-2]
59331 [Q13342-3]
59332 [Q13342-4]

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263 [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263 [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263 [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263 [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263 [Q13342-5]
GeneIDi11262
KEGGihsa:11262
UCSCiuc002vqj.4 human [Q13342-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11262
DisGeNETi11262

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SP140
HGNCiHGNC:17133 SP140
HPAiHPA006162
HPA067493
MIMi608602 gene
neXtProtiNX_Q13342
OpenTargetsiENSG00000079263
PharmGKBiPA38205

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2177 Eukaryota
ENOG4111G04 LUCA
GeneTreeiENSGT00940000162129
HOGENOMiHOG000089984
InParanoidiQ13342
OMAiNPPRKYF
OrthoDBi377499at2759
PhylomeDBiQ13342
TreeFamiTF335091

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SP140 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11262
PharosiQ13342

Protein Ontology

More...
PROi
PR:Q13342

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000079263 Expressed in 122 organ(s), highest expression level in small intestine Peyer's patch
ExpressionAtlasiQ13342 baseline and differential
GenevisibleiQ13342 HS

Family and domain databases

Gene3Di1.20.920.10, 1 hit
3.10.390.10, 1 hit
InterProiView protein in InterPro
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR004865 HSR_dom
IPR010919 SAND-like_dom_sf
IPR000770 SAND_dom
IPR030411 SP140
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
PANTHERiPTHR46386:SF2 PTHR46386:SF2, 1 hit
PfamiView protein in Pfam
PF00439 Bromodomain, 1 hit
PF03172 HSR, 1 hit
PF01342 SAND, 1 hit
SMARTiView protein in SMART
SM00297 BROMO, 1 hit
SM00249 PHD, 1 hit
SM00258 SAND, 1 hit
SUPFAMiSSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit
SSF63763 SSF63763, 1 hit
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS51414 HSR, 1 hit
PS50864 SAND, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSP140_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13342
Secondary accession number(s): E7ESH9
, E7EUR5, E9PFJ6, Q0VGE5, Q13341, Q3KR17, Q4ZG66, Q53TG1, Q6NSG4, Q92881, Q96TG3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 16, 2008
Last modified: October 16, 2019
This is version 174 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again