Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Metastasis-associated protein MTA1

Gene

MTA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional coregulator which can act as both a transcriptional corepressor and coactivator. As a part of the histone-deacetylase multiprotein complex (NuRD), regulates transcription of its targets by modifying the acetylation status of the target chromatin and cofactor accessibility to the target DNA. In conjunction with other components of NuRD, acts as a transcriptional corepressor of BRCA1, ESR1, TFF1 and CDKN1A. Acts as a transcriptional coactivator of BCAS3, PAX5 and SUMO2, independent of the NuRD complex. Stimulates the expression of WNT1 by inhibiting the expression of its transcriptional corepressor SIX3. Regulates p53-dependent and -independent DNA repair processes following genotoxic stress. Regulates the stability and function of p53/TP53 by inhibiting its ubiquitination by COP1 and MDM2 thereby regulating the p53-dependent DNA repair. Plays an important role in tumorigenesis, tumor invasion, and metastasis. Involved in the epigenetic regulation of ESR1 expression in breast cancer in a TFAP2C, IFI16 and HDAC4/5/6-dependent manner. Plays a role in the regulation of the circadian clock and is essential for the generation and maintenance of circadian rhythms under constant light and for normal entrainment of behavior to light-dark (LD) cycles. Positively regulates the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of its own transcription and the transcription of CRY1. Regulates deacetylation of ARNTL/BMAL1 by regulating SIRT1 expression, resulting in derepressing CRY1-mediated transcription repression. Isoform Short binds to ESR1 and sequesters it in the cytoplasm and enhances its non-genomic responses. With TFCP2L1, promotes establishment and maintenance of pluripotency in embryonic stem cells (ESCs) and inhibits endoderm differentiation (By similarity).By similarity6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri393 – 420GATA-type; atypicalAdd BLAST28

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processBiological rhythms, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214815 HDACs deacetylate histones
R-HSA-3232118 SUMOylation of transcription factors
R-HSA-427389 ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-8943724 Regulation of PTEN gene transcription

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13330

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Metastasis-associated protein MTA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MTA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182979.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7410 MTA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603526 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13330

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi182K → A: Reduced ubiquitination. Significant reduction in ubiquitination; when associated with A-626. 1 Publication1
Mutagenesisi509K → R: Reduced sumoylation and transcriptional corepressor activity. 1 Publication1
Mutagenesisi626K → A: Loss of acetylation and transcriptional coactivator activity. Reduced ubiquitination. Significant reduction in ubiquitination; when associated with A-182. 3 Publications1
Mutagenesisi711 – 713IVI → AAA: Significant loss of interaction with SUMO1 and SUMO2 and reduced transcriptional corepressor activity. 1 Publication3

Organism-specific databases

DisGeNET

More...
DisGeNETi
9112

Open Targets

More...
OpenTargetsi
ENSG00000182979

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31218

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MTA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
259016275

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000834931 – 715Metastasis-associated protein MTA1Add BLAST715

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki182Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei386PhosphoserineCombined sources1
Modified residuei446PhosphoserineCombined sources1
Modified residuei449PhosphoserineCombined sources1
Cross-linki509Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2 and SUMO3)
Modified residuei522PhosphoserineCombined sources1
Cross-linki549Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei564PhosphothreonineCombined sources1
Modified residuei576PhosphoserineCombined sources1
Modified residuei578PhosphothreonineCombined sources1
Modified residuei626N6-acetyllysine; alternate3 Publications1
Cross-linki626Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate1 Publication
Modified residuei639PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by CSNK1G2/CK1 triggered by estrogen enhances corepression of estrogen receptor (ER).1 Publication
Acetylation is essential for its transcriptional coactivator activity.3 Publications
Sumoylation positively regulates its transcriptional corepressor activity but does not affect the protein stability. Sumoylated preferentially by SUMO2 or SUMO3 than SUMO1. Sumoylation is enhanced by PIAS1/3/4 and preferentially sumoylated by SUMO2 in the presence of PIAS1/3/4. Desumoylated by SENP1.1 Publication
Ubiquitinated by COP1, which leads to proteasomal degradation.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q13330

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13330

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13330

PeptideAtlas

More...
PeptideAtlasi
Q13330

PRoteomics IDEntifications database

More...
PRIDEi
Q13330

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59317
59318 [Q13330-2]
59319 [Q13330-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13330

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q13330

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. High expression in brain, liver, kidney, and cardiac muscle, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual. Up-regulated in a wide variety of cancers including breast, liver, ovarian, and colorectal cancer and its expression levels are closely correlated with tumor aggressiveness and metastasis.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highly expressed in metastatic cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182979 Expressed in 231 organ(s), highest expression level in left lobe of thyroid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_MTA1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13330 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13330 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004508
HPA005544

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the nucleosome-remodeling and histone-deacetylase multiprotein complex (NuRD). Interacts with HDAC1 and ITGB3BP/CENPR. Binds to CSNK1G2 in the cytoplasm. Interacts with NACC2. Interacts with ARNTL/BMAL1 and CLOCK. Interacts with EP300, TFAP2C, IFI16, TPR, HDAC2, UBE2I/UBC9, PIAS1, PIAS3, PIAS4, p53/TP53, MDM2, COP1, SUMO1, SUMO2, SENP1 and SENP2. Interacts with SIX3; facilitates the binding of SIX3 to the core DNA motif of SIX3 promoter (By similarity). Interacts with TFCP2L1; which is indispensable for TFCP2L1-mediated self-renewal-promoting effect and endoderm-inhibiting action (By similarity).By similarity12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114562, 117 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-880 MBD2/NuRD nucleosome remodeling and deacetylase complex
CPX-922 MBD3/NuRD nucleosome remodeling and deacetylase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q13330

Database of interacting proteins

More...
DIPi
DIP-41751N

Protein interaction database and analysis system

More...
IntActi
Q13330, 71 interactors

Molecular INTeraction database

More...
MINTi
Q13330

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000333633

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1715
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q13330

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13330

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 164BAHPROSITE-ProRule annotationAdd BLAST164
Domaini165 – 276ELM2PROSITE-ProRule annotationAdd BLAST112
Domaini283 – 335SANTPROSITE-ProRule annotationAdd BLAST53

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi545 – 552SH3-bindingSequence analysis8
Motifi696 – 705SH3-bindingSequence analysis10
Motifi711 – 715SUMO interaction motif 1 (SIM); crucial for efficient sumoylation5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi697 – 705Poly-Pro9

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoform Short contains a Leu-Arg-Ile-Leu-Leu motif (ER binding motif).

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri393 – 420GATA-type; atypicalAdd BLAST28

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3554 Eukaryota
ENOG410XSAJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153977

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000045387

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG002598

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13330

KEGG Orthology (KO)

More...
KOi
K11660

Identification of Orthologs from Complete Genome Data

More...
OMAi
NNGKPCE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04Z4

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13330

TreeFam database of animal gene trees

More...
TreeFami
TF106444

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00202 ZnF_GATA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001025 BAH_dom
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR040138 MIER/MTA
IPR035170 MTA1_R1
IPR001005 SANT/Myb
IPR017884 SANT_dom
IPR000679 Znf_GATA

The PANTHER Classification System

More...
PANTHERi
PTHR10865 PTHR10865, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01426 BAH, 1 hit
PF01448 ELM2, 1 hit
PF00320 GATA, 1 hit
PF17226 MTA_R1, 2 hits
PF00249 Myb_DNA-binding, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00439 BAH, 1 hit
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit
SM00401 ZnF_GATA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51038 BAH, 1 hit
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: Q13330-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAANMYRVGD YVYFENSSSN PYLIRRIEEL NKTANGNVEA KVVCFYRRRD
60 70 80 90 100
ISSTLIALAD KHATLSVCYK AGPGADNGEE GEIEEEMENP EMVDLPEKLK
110 120 130 140 150
HQLRHRELFL SRQLESLPAT HIRGKCSVTL LNETESLKSY LEREDFFFYS
160 170 180 190 200
LVYDPQQKTL LADKGEIRVG NRYQADITDL LKEGEEDGRD QSRLETQVWE
210 220 230 240 250
AHNPLTDKQI DQFLVVARSV GTFARALDCS SSVRQPSLHM SAAAASRDIT
260 270 280 290 300
LFHAMDTLHK NIYDISKAIS ALVPQGGPVL CRDEMEEWSA SEANLFEEAL
310 320 330 340 350
EKYGKDFTDI QQDFLPWKSL TSIIEYYYMW KTTDRYVQQK RLKAAEAESK
360 370 380 390 400
LKQVYIPNYN KPNPNQISVN NVKAGVVNGT GAPGQSPGAG RACESCYTTQ
410 420 430 440 450
SYQWYSWGPP NMQCRLCASC WTYWKKYGGL KMPTRLDGER PGPNRSNMSP
460 470 480 490 500
HGLPARSSGS PKFAMKTRQA FYLHTTKLTR IARRLCREIL RPWHAARHPY
510 520 530 540 550
LPINSAAIKA ECTARLPEAS QSPLVLKQAV RKPLEAVLRY LETHPRPPKP
560 570 580 590 600
DPVKSVSSVL SSLTPAKVAP VINNGSPTIL GKRSYEQHNG VDGNMKKRLL
610 620 630 640 650
MPSRGLANHG QARHMGPSRN LLLNGKSYPT KVRLIRGGSL PPVKRRRMNW
660 670 680 690 700
IDAPDDVFYM ATEETRKIRK LLSSSETKRA ARRPYKPIAL RQSQALPPRP
710
PPPAPVNDEP IVIED
Length:715
Mass (Da):80,786
Last modified:September 22, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2D5330F0489AE62E
GO
Isoform Short (identifier: Q13330-2) [UniParc]FASTAAdd to basket
Also known as: MTA1S

The sequence of this isoform differs from the canonical sequence as follows:
     398-430: TTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGL → MSSLRILLDILEEIWWLENANPVRWREARTKPQ
     431-715: Missing.

Show »
Length:430
Mass (Da):49,017
Checksum:iDE4B752E9476C6CE
GO
Isoform 3 (identifier: Q13330-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-81: TLSVCYKAGPGADNGEEG → R

Show »
Length:698
Mass (Da):79,192
Checksum:iBCF775330376172E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ESY4E7ESY4_HUMAN
Metastasis-associated protein MTA1
MTA1
703Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4T7H0Y4T7_HUMAN
Metastasis-associated protein MTA1
MTA1
511Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W9Y9F8W9Y9_HUMAN
Metastasis-associated protein MTA1
MTA1
255Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIT0H0YIT0_HUMAN
Metastasis-associated protein MTA1
MTA1
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3F3H7C3F3_HUMAN
Metastasis-associated protein MTA1
MTA1
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti498H → N in AAA78935 (PubMed:8083195).Curated1
Sequence conflicti545P → R in AAI42942 (PubMed:15489334).Curated1
Sequence conflicti655D → G in AAA78935 (PubMed:8083195).Curated1
Sequence conflicti661 – 662AT → PK in AAA78935 (PubMed:8083195).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055847372V → I. Corresponds to variant dbSNP:rs4983413Ensembl.1
Natural variantiVAR_058965612A → T3 PublicationsCorresponds to variant dbSNP:rs13707Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04220764 – 81TLSVC…NGEEG → R in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_001601398 – 430TTQSY…KYGGL → MSSLRILLDILEEIWWLENA NPVRWREARTKPQ in isoform Short. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_001602431 – 715Missing in isoform Short. 1 PublicationAdd BLAST285

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U35113 mRNA Translation: AAA78935.1
AF508978 mRNA Translation: AAN01613.1
AL928654 Genomic DNA No translation available.
BC009443 mRNA Translation: AAH09443.2
BC142941 mRNA Translation: AAI42942.1
BX248776 mRNA Translation: CAD66583.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32169.1 [Q13330-1]
CCDS55954.1 [Q13330-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001190187.1, NM_001203258.1 [Q13330-2]
NP_004680.2, NM_004689.3 [Q13330-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.525629

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000331320; ENSP00000333633; ENSG00000182979 [Q13330-1]
ENST00000405646; ENSP00000384180; ENSG00000182979 [Q13330-3]
ENST00000438610; ENSP00000393438; ENSG00000182979 [Q13330-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9112

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9112

UCSC genome browser

More...
UCSCi
uc001yqx.4 human [Q13330-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U35113 mRNA Translation: AAA78935.1
AF508978 mRNA Translation: AAN01613.1
AL928654 Genomic DNA No translation available.
BC009443 mRNA Translation: AAH09443.2
BC142941 mRNA Translation: AAI42942.1
BX248776 mRNA Translation: CAD66583.1
CCDSiCCDS32169.1 [Q13330-1]
CCDS55954.1 [Q13330-2]
RefSeqiNP_001190187.1, NM_001203258.1 [Q13330-2]
NP_004680.2, NM_004689.3 [Q13330-1]
UniGeneiHs.525629

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4BKXX-ray3.00A162-335[»]
4PBYX-ray2.50C/D656-686[»]
4PBZX-ray2.15B670-695[»]
4PC0X-ray2.50C/D670-711[»]
5FXYX-ray3.20B/D/F/H464-546[»]
5ICNX-ray3.30A162-354[»]
6G16X-ray2.80B/D/F/H464-546[»]
ProteinModelPortaliQ13330
SMRiQ13330
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114562, 117 interactors
ComplexPortaliCPX-880 MBD2/NuRD nucleosome remodeling and deacetylase complex
CPX-922 MBD3/NuRD nucleosome remodeling and deacetylase complex
CORUMiQ13330
DIPiDIP-41751N
IntActiQ13330, 71 interactors
MINTiQ13330
STRINGi9606.ENSP00000333633

PTM databases

iPTMnetiQ13330
PhosphoSitePlusiQ13330

Polymorphism and mutation databases

BioMutaiMTA1
DMDMi259016275

Proteomic databases

EPDiQ13330
MaxQBiQ13330
PaxDbiQ13330
PeptideAtlasiQ13330
PRIDEiQ13330
ProteomicsDBi59317
59318 [Q13330-2]
59319 [Q13330-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9112
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331320; ENSP00000333633; ENSG00000182979 [Q13330-1]
ENST00000405646; ENSP00000384180; ENSG00000182979 [Q13330-3]
ENST00000438610; ENSP00000393438; ENSG00000182979 [Q13330-2]
GeneIDi9112
KEGGihsa:9112
UCSCiuc001yqx.4 human [Q13330-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9112
DisGeNETi9112
EuPathDBiHostDB:ENSG00000182979.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MTA1
HGNCiHGNC:7410 MTA1
HPAiCAB004508
HPA005544
MIMi603526 gene
neXtProtiNX_Q13330
OpenTargetsiENSG00000182979
PharmGKBiPA31218

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3554 Eukaryota
ENOG410XSAJ LUCA
GeneTreeiENSGT00940000153977
HOGENOMiHOG000045387
HOVERGENiHBG002598
InParanoidiQ13330
KOiK11660
OMAiNNGKPCE
OrthoDBiEOG091G04Z4
PhylomeDBiQ13330
TreeFamiTF106444

Enzyme and pathway databases

ReactomeiR-HSA-3214815 HDACs deacetylate histones
R-HSA-3232118 SUMOylation of transcription factors
R-HSA-427389 ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-8943724 Regulation of PTEN gene transcription
SIGNORiQ13330

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MTA1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MTA1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9112

Protein Ontology

More...
PROi
PR:Q13330

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182979 Expressed in 231 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_MTA1
ExpressionAtlasiQ13330 baseline and differential
GenevisibleiQ13330 HS

Family and domain databases

CDDicd00202 ZnF_GATA, 1 hit
InterProiView protein in InterPro
IPR001025 BAH_dom
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR040138 MIER/MTA
IPR035170 MTA1_R1
IPR001005 SANT/Myb
IPR017884 SANT_dom
IPR000679 Znf_GATA
PANTHERiPTHR10865 PTHR10865, 1 hit
PfamiView protein in Pfam
PF01426 BAH, 1 hit
PF01448 ELM2, 1 hit
PF00320 GATA, 1 hit
PF17226 MTA_R1, 2 hits
PF00249 Myb_DNA-binding, 1 hit
SMARTiView protein in SMART
SM00439 BAH, 1 hit
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit
SM00401 ZnF_GATA, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS51038 BAH, 1 hit
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTA1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13330
Secondary accession number(s): A5PLK4
, Q86SW2, Q8NFI8, Q96GI8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 22, 2009
Last modified: December 5, 2018
This is version 191 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again