Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13324 (CRFR2_HUMAN)

Entry version 164 (16 Oct 2019)
Sequence version 2 (30 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Corticotropin-releasing factor receptor 2

Gene

CRHR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-373080 Class B/2 (Secretin family receptors)
R-HSA-418555 G alpha (s) signalling events
R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Corticotropin-releasing factor receptor 2
Short name:
CRF-R-2
Short name:
CRF-R2
Short name:
CRFR-2
Alternative name(s):
Corticotropin-releasing hormone receptor 2
Short name:
CRH-R-2
Short name:
CRH-R2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CRHR2
Synonyms:CRF2R, CRH2R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:2358 CRHR2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602034 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13324

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 108ExtracellularBy similarityAdd BLAST108
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei109 – 139Helical; Name=1By similarityAdd BLAST31
Topological domaini140 – 146CytoplasmicBy similarity7
Transmembranei147 – 171Helical; Name=2By similarityAdd BLAST25
Topological domaini172 – 185ExtracellularBy similarityAdd BLAST14
Transmembranei186 – 214Helical; Name=3By similarityAdd BLAST29
Topological domaini215 – 221CytoplasmicBy similarity7
Transmembranei222 – 249Helical; Name=4By similarityAdd BLAST28
Topological domaini250 – 265ExtracellularBy similarityAdd BLAST16
Transmembranei266 – 291Helical; Name=5By similarityAdd BLAST26
Topological domaini292 – 302CytoplasmicBy similarityAdd BLAST11
Transmembranei303 – 327Helical; Name=6By similarityAdd BLAST25
Topological domaini328 – 334ExtracellularBy similarity7
Transmembranei335 – 364Helical; Name=7By similarityAdd BLAST30
Topological domaini365 – 411CytoplasmicBy similarityAdd BLAST47

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		1395

Open Targets

More...OpenTargetsi		ENSG00000106113

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26875

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13324

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4069

DrugCentral

More...DrugCentrali		Q13324

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		213

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CRHR2

Domain mapping of disease mutations (DMDM)

More...DMDMi		6226847

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000128201 – 411Corticotropin-releasing factor receptor 2Add BLAST411
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Not cleavedAdd BLAST19

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi13N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi14 ↔ 501 Publication
Disulfide bondi40 ↔ 831 Publication
Glycosylationi41N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi64 ↔ 981 Publication
Glycosylationi74N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi94N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi184 ↔ 254By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

A N-glycosylation site within the signal peptide impedes its proper cleavage and function.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13324

PeptideAtlas

More...PeptideAtlasi		Q13324

PRoteomics IDEntifications database

More...PRIDEi		Q13324

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		30449
59312 [Q13324-1]
59313 [Q13324-2]
59314 [Q13324-3]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13324

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000106113 Expressed in 83 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13324 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13324 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA046683

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

Interacts (via N-terminal extracellular domain) with CRF, UCN, UCN2 and UCN3. Has highest affinity for UCN, and considerably lower affinity for CRF, UNC2 and UCN3.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107785, 2 interactors

Protein interaction database and analysis system

More...IntActi		Q13324, 1 interactor

Molecular INTeraction database

More...MINTi		Q13324

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000340943

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q13324

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13324

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q13324

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The transmembrane domain is composed of seven transmembrane helices that are arranged in V-shape. Transmembrane helix 7 assumes a sharply kinked structure (By similarity).By similarity
The uncleaved pseudo signal peptide prevents receptor's oligomerization and coupling to G(i) subunits. It is also responsible for the rather low receptor localization at the plasma membrane (PubMed:22689579).1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 2 family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4564 Eukaryota
ENOG410XRS2 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156795

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000230719

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13324

KEGG Orthology (KO)

More...KOi		K04579

Identification of Orthologs from Complete Genome Data

More...OMAi		VYNYFVV

Database of Orthologous Groups

More...OrthoDBi		1163977at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q13324

TreeFam database of animal gene trees

More...TreeFami		TF315710

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		4.10.1240.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR017981 GPCR_2-like
IPR003053 GPCR_2_CRF2_rcpt
IPR003051 GPCR_2_CRF_rcpt
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01279 CRFRECEPTOR
PR01281 CRFRECEPTOR2
PR00249 GPCRSECRETIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00008 HormR, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF111418 SSF111418, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform CRF2-alpha (identifier: Q13324-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAALLHSLL EANCSLALAE ELLLDGWGPP LDPEGPYSYC NTTLDQIGTC 
        60         70         80         90        100
WPRSAAGALV ERPCPEYFNG VKYNTTRNAY RECLENGTWA SKINYSQCEP 
       110        120        130        140        150
ILDDKQRKYD LHYRIALVVN YLGHCVSVAA LVAAFLLFLA LRSIRCLRNV 
       160        170        180        190        200
IHWNLITTFI LRNVMWFLLQ LVDHEVHESN EVWCRCITTI FNYFVVTNFF 
       210        220        230        240        250
WMFVEGCYLH TAIVMTYSTE RLRKCLFLFI GWCIPFPIIV AWAIGKLYYE 
       260        270        280        290        300
NEQCWFGKEP GDLVDYIYQG PIILVLLINF VFLFNIVRIL MTKLRASTTS 
       310        320        330        340        350
ETIQYRKAVK ATLVLLPLLG ITYMLFFVNP GEDDLSQIMF IYFNSFLQSF 
       360        370        380        390        400
QGFFVSVFYC FFNGEVRSAV RKRWHRWQDH HSLRVPMARA MSIPTSPTRI 
       410 
SFHSIKQTAA V
Length:411
Mass (Da):47,688
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i96B99A93594CF07F
GO
Isoform CRF2-beta (identifier: Q13324-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDAALLHSLLEANCSLALAEELLLDGWGPPLDPE → MRGPSGPPGL...HTIMTLTNLS

Note: Contains a disulfide bond in positions 51-77.
Show »
Length:438
Mass (Da):50,814
Checksum:i64E8A977B3A40DE4
GO
Isoform CRF2-gamma (identifier: Q13324-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDAALLHSLLEANCSLALAEELLLDGWGPPLDPE → MGREPWPEDRDLGFPQLFCQ

Show »
Length:397
Mass (Da):46,491
Checksum:i6156D0F559CA678B
GO
Isoform D (identifier: Q13324-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     366-411: VRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV → SWVSKEAQAAGPHGREKPEQRW

Show »
Length:387
Mass (Da):44,831
Checksum:iF4813C5F7FF2E46D
GO
Isoform E (identifier: Q13324-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     366-411: VRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV → GLEPV

Show »
Length:370
Mass (Da):42,810
Checksum:iE33FAA767F133C69
GO
Isoform F (identifier: Q13324-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-411: Missing.

Show »
Length:366
Mass (Da):42,414
Checksum:i95A33C69FE9CE201
GO
Isoform desQ (identifier: Q13324-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: Missing.

Show »
Length:410
Mass (Da):47,560
Checksum:iEB3D216BD6B2D6AD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z2M6F2Z2M6_HUMAN
Corticotropin-releasing factor rece...
CRHR2
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZM9C9JZM9_HUMAN
Corticotropin-releasing factor rece...
CRHR2
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti185R → H in AAA91320 (PubMed:8536644).Curated1
Sequence conflicti185R → H in ABV59313 (Ref. 6) Curated1
Sequence conflicti185R → H in ABV59314 (Ref. 6) Curated1
Sequence conflicti185R → H in ABV59315 (Ref. 6) Curated1
Sequence conflicti185R → H in ABV59317 (Ref. 6) Curated1
Sequence conflicti374W → R in BAG36414 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049455220E → D. Corresponds to variant dbSNP:rs34625936Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0019991 – 34MDAAL…PLDPE → MRGPSGPPGLLYVPHLLLCL LCLLPPPLQYAAGQSQMPKD QPLWALLEQYCHTIMTLTNL S in isoform CRF2-beta. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_0020001 – 34MDAAL…PLDPE → MGREPWPEDRDLGFPQLFCQ in isoform CRF2-gamma. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_053564106Missing in isoform desQ. 1 Publication1
Alternative sequenceiVSP_053565366 – 411VRSAV…QTAAV → SWVSKEAQAAGPHGREKPEQ RW in isoform D. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_053566366 – 411VRSAV…QTAAV → GLEPV in isoform E. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_053567367 – 411Missing in isoform F. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U34587 mRNA Translation: AAA91320.1
AF011406 mRNA Translation: AAB94503.1
AF019381 mRNA Translation: AAB94562.1
AB065699 Genomic DNA Translation: BAC05922.1
AY449734 mRNA Translation: AAR18078.1
EU012439 mRNA Translation: ABV59313.1
EU012440 mRNA Translation: ABV59314.1
EU012441 mRNA Translation: ABV59315.1
EU012443 mRNA Translation: ABV59317.1
AK313661 mRNA Translation: BAG36414.1
AC004976 Genomic DNA Translation: AAC71653.1
AC004976 Genomic DNA Translation: AAC71654.1
BC096830 mRNA Translation: AAH96830.1
Y10151 mRNA Translation: CAA71235.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5429.1 [Q13324-1]
CCDS56477.1 [Q13324-3]
CCDS56478.1 [Q13324-2]
CCDS75576.1 [Q13324-4]

NCBI Reference Sequences

More...RefSeqi		NP_001189404.1, NM_001202475.1 [Q13324-2]
NP_001189410.1, NM_001202481.1 [Q13324-3]
NP_001189411.1, NM_001202482.1 [Q13324-7]
NP_001189412.1, NM_001202483.1 [Q13324-4]
NP_001874.2, NM_001883.4 [Q13324-1]
XP_011513430.1, XM_011515128.2
XP_011513431.1, XM_011515129.2
XP_016867241.1, XM_017011752.1 [Q13324-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000341843; ENSP00000344304; ENSG00000106113 [Q13324-3]
ENST00000348438; ENSP00000340943; ENSG00000106113 [Q13324-2]
ENST00000471646; ENSP00000418722; ENSG00000106113 [Q13324-1]
ENST00000506074; ENSP00000426498; ENSG00000106113 [Q13324-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1395

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1395

UCSC genome browser

More...UCSCi		uc003tbn.4 human [Q13324-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U34587 mRNA Translation: AAA91320.1
AF011406 mRNA Translation: AAB94503.1
AF019381 mRNA Translation: AAB94562.1
AB065699 Genomic DNA Translation: BAC05922.1
AY449734 mRNA Translation: AAR18078.1
EU012439 mRNA Translation: ABV59313.1
EU012440 mRNA Translation: ABV59314.1
EU012441 mRNA Translation: ABV59315.1
EU012443 mRNA Translation: ABV59317.1
AK313661 mRNA Translation: BAG36414.1
AC004976 Genomic DNA Translation: AAC71653.1
AC004976 Genomic DNA Translation: AAC71654.1
BC096830 mRNA Translation: AAH96830.1
Y10151 mRNA Translation: CAA71235.1
CCDSiCCDS5429.1 [Q13324-1]
CCDS56477.1 [Q13324-3]
CCDS56478.1 [Q13324-2]
CCDS75576.1 [Q13324-4]
RefSeqiNP_001189404.1, NM_001202475.1 [Q13324-2]
NP_001189410.1, NM_001202481.1 [Q13324-3]
NP_001189411.1, NM_001202482.1 [Q13324-7]
NP_001189412.1, NM_001202483.1 [Q13324-4]
NP_001874.2, NM_001883.4 [Q13324-1]
XP_011513430.1, XM_011515128.2
XP_011513431.1, XM_011515129.2
XP_016867241.1, XM_017011752.1 [Q13324-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3N93X-ray2.50A/B3-104[»]
3N95X-ray2.72A/B/C/D3-104[»]
3N96X-ray2.75A/B/C/D3-104[»]
SMRiQ13324
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi107785, 2 interactors
IntActiQ13324, 1 interactor
MINTiQ13324
STRINGi9606.ENSP00000340943

Chemistry databases

BindingDBiQ13324
ChEMBLiCHEMBL4069
DrugCentraliQ13324
GuidetoPHARMACOLOGYi213

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

PhosphoSitePlusiQ13324

Polymorphism and mutation databases

BioMutaiCRHR2
DMDMi6226847

Proteomic databases

PaxDbiQ13324
PeptideAtlasiQ13324
PRIDEiQ13324
ProteomicsDBi30449
59312 [Q13324-1]
59313 [Q13324-2]
59314 [Q13324-3]

Genome annotation databases

EnsembliENST00000341843; ENSP00000344304; ENSG00000106113 [Q13324-3]
ENST00000348438; ENSP00000340943; ENSG00000106113 [Q13324-2]
ENST00000471646; ENSP00000418722; ENSG00000106113 [Q13324-1]
ENST00000506074; ENSP00000426498; ENSG00000106113 [Q13324-4]
GeneIDi1395
KEGGihsa:1395
UCSCiuc003tbn.4 human [Q13324-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1395
DisGeNETi1395

GeneCards: human genes, protein and diseases

More...GeneCardsi		CRHR2
HGNCiHGNC:2358 CRHR2
HPAiHPA046683
MIMi602034 gene
neXtProtiNX_Q13324
OpenTargetsiENSG00000106113
PharmGKBiPA26875

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4564 Eukaryota
ENOG410XRS2 LUCA
GeneTreeiENSGT00940000156795
HOGENOMiHOG000230719
InParanoidiQ13324
KOiK04579
OMAiVYNYFVV
OrthoDBi1163977at2759
PhylomeDBiQ13324
TreeFamiTF315710

Enzyme and pathway databases

ReactomeiR-HSA-373080 Class B/2 (Secretin family receptors)
R-HSA-418555 G alpha (s) signalling events
R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CRHR2 human
EvolutionaryTraceiQ13324

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Corticotropin_releasing_hormone_receptor_2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1395
PharosiQ13324

Protein Ontology

More...PROi		PR:Q13324

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000106113 Expressed in 83 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ13324 baseline and differential
GenevisibleiQ13324 HS

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR017981 GPCR_2-like
IPR003053 GPCR_2_CRF2_rcpt
IPR003051 GPCR_2_CRF_rcpt
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit
PRINTSiPR01279 CRFRECEPTOR
PR01281 CRFRECEPTOR2
PR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00008 HormR, 1 hit
SUPFAMiSSF111418 SSF111418, 1 hit
PROSITEiView protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCRFR2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13324
Secondary accession number(s): B2R967
, B3SXS6, B3SXS7, B3SXS8, B3SXT0, F8WA81, O43461, Q4QRJ4, Q99431
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 30, 2000
Last modified: October 16, 2019
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again