Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Inactive tyrosine-protein kinase 7

Gene

PTK7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.5 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processCell adhesion, Wnt signaling pathway

Enzyme and pathway databases

SIGNORiQ13308

Names & Taxonomyi

Protein namesi
Recommended name:
Inactive tyrosine-protein kinase 7
Alternative name(s):
Colon carcinoma kinase 4
Short name:
CCK-4
Protein-tyrosine kinase 7
Pseudo tyrosine kinase receptor 7
Tyrosine-protein kinase-like 7
Gene namesi
Name:PTK7
Synonyms:CCK4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000112655.15
HGNCiHGNC:9618 PTK7
MIMi601890 gene
neXtProtiNX_Q13308

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini31 – 704ExtracellularSequence analysisAdd BLAST674
Transmembranei705 – 725HelicalSequence analysisAdd BLAST21
Topological domaini726 – 1070CytoplasmicSequence analysisAdd BLAST345

Keywords - Cellular componenti

Cell junction, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi622L → D: Prevents proteolysis by MMP14. 1 Publication1
Mutagenesisi641M → R: No impact on proteolysis by MMP14. 1 Publication1
Mutagenesisi701M → D: No impact on proteolysis by MMP14. 1 Publication1

Organism-specific databases

DisGeNETi5754
OpenTargetsiENSG00000112655
PharmGKBiPA33961

Polymorphism and mutation databases

BioMutaiPTK7
DMDMi116242736

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000001674831 – 1070Inactive tyrosine-protein kinase 7Add BLAST1040

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi53 ↔ 101PROSITE-ProRule annotation
Glycosylationi116N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi150 ↔ 200PROSITE-ProRule annotation
Glycosylationi175N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi214N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi246 ↔ 301PROSITE-ProRule annotation
Glycosylationi268N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi283N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi343 ↔ 391PROSITE-ProRule annotation
Glycosylationi405N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi433 ↔ 481PROSITE-ProRule annotation
Glycosylationi463N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi524 ↔ 570PROSITE-ProRule annotation
Glycosylationi567N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi613 ↔ 664PROSITE-ProRule annotation
Glycosylationi646N-linked (GlcNAc...) asparagine2 Publications1
Modified residuei1064PhosphoserineBy similarity1

Post-translational modificationi

MMP14 cleaves PTK7 between Pro-621 and Leu-622 generating an N-terminal soluble (70 kDa) fragment and a membrane C-terminal (50 kDa) fragment. Proteolysis by MMP14 regulates PTK7 function in non-canonical Wnt signaling pathway.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei621 – 622Cleavage; by MMP142

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ13308
MaxQBiQ13308
PaxDbiQ13308
PeptideAtlasiQ13308
PRIDEiQ13308
ProteomicsDBi59293
59294 [Q13308-2]
59295 [Q13308-3]
59296 [Q13308-4]
59297 [Q13308-5]
TopDownProteomicsiQ13308-3 [Q13308-3]

PTM databases

GlyConnecti655
iPTMnetiQ13308
PhosphoSitePlusiQ13308
SwissPalmiQ13308
UniCarbKBiQ13308

Expressioni

Tissue specificityi

Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

Inductioni

Higher expression in cell lines established from normal non-tumorigenic tissues compared to cell lines established from highly metastatic invasive carcinomas (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000112655 Expressed in 147 organ(s), highest expression level in myometrium
CleanExiHS_PTK7
ExpressionAtlasiQ13308 baseline and differential
GenevisibleiQ13308 HS

Organism-specific databases

HPAiHPA003222

Interactioni

Subunit structurei

Interacts with CTNNB1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CTNNB1P352225EBI-2803245,EBI-491549

Protein-protein interaction databases

BioGridi111721, 45 interactors
IntActiQ13308, 18 interactors
MINTiQ13308
STRINGi9606.ENSP00000230419

Structurei

3D structure databases

ProteinModelPortaliQ13308
SMRiQ13308
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 120Ig-like C2-type 1Add BLAST90
Domaini128 – 218Ig-like C2-type 2Add BLAST91
Domaini225 – 317Ig-like C2-type 3Add BLAST93
Domaini309 – 407Ig-like C2-type 4Add BLAST99
Domaini412 – 497Ig-like C2-type 5Add BLAST86
Domaini503 – 586Ig-like C2-type 6Add BLAST84
Domaini578 – 680Ig-like C2-type 7Add BLAST103
Domaini796 – 1066Protein kinase; inactivePROSITE-ProRule annotationAdd BLAST271

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni794 – 1070Interaction with CTNNB11 PublicationAdd BLAST277

Domaini

The protein kinase domain is predicted to be catalytically inactive.

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1026 Eukaryota
KOG4475 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00760000118818
HOGENOMiHOG000115767
HOVERGENiHBG008320
InParanoidiQ13308
KOiK05127
OMAiGISHKGV
OrthoDBiEOG091G0BWE
PhylomeDBiQ13308
TreeFamiTF326835

Family and domain databases

Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR033592 PTK7
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008266 Tyr_kinase_AS
PANTHERiPTHR26391:SF15 PTHR26391:SF15, 2 hits
PfamiView protein in Pfam
PF07679 I-set, 3 hits
PF07714 Pkinase_Tyr, 1 hit
PRINTSiPR00109 TYRKINASE
SMARTiView protein in SMART
SM00409 IG, 7 hits
SM00408 IGc2, 7 hits
SUPFAMiSSF48726 SSF48726, 7 hits
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 7 hits
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13308-1) [UniParc]FASTAAdd to basket
Also known as: PTK7-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAARGSPAR PRRLPLLSVL LLPLLGGTQT AIVFIKQPSS QDALQGRRAL
60 70 80 90 100
LRCEVEAPGP VHVYWLLDGA PVQDTERRFA QGSSLSFAAV DRLQDSGTFQ
110 120 130 140 150
CVARDDVTGE EARSANASFN IKWIEAGPVV LKHPASEAEI QPQTQVTLRC
160 170 180 190 200
HIDGHPRPTY QWFRDGTPLS DGQSNHTVSS KERNLTLRPA GPEHSGLYSC
210 220 230 240 250
CAHSAFGQAC SSQNFTLSIA DESFARVVLA PQDVVVARYE EAMFHCQFSA
260 270 280 290 300
QPPPSLQWLF EDETPITNRS RPPHLRRATV FANGSLLLTQ VRPRNAGIYR
310 320 330 340 350
CIGQGQRGPP IILEATLHLA EIEDMPLFEP RVFTAGSEER VTCLPPKGLP
360 370 380 390 400
EPSVWWEHAG VRLPTHGRVY QKGHELVLAN IAESDAGVYT CHAANLAGQR
410 420 430 440 450
RQDVNITVAT VPSWLKKPQD SQLEEGKPGY LDCLTQATPK PTVVWYRNQM
460 470 480 490 500
LISEDSRFEV FKNGTLRINS VEVYDGTWYR CMSSTPAGSI EAQARVQVLE
510 520 530 540 550
KLKFTPPPQP QQCMEFDKEA TVPCSATGRE KPTIKWERAD GSSLPEWVTD
560 570 580 590 600
NAGTLHFARV TRDDAGNYTC IASNGPQGQI RAHVQLTVAV FITFKVEPER
610 620 630 640 650
TTVYQGHTAL LQCEAQGDPK PLIQWKGKDR ILDPTKLGPR MHIFQNGSLV
660 670 680 690 700
IHDVAPEDSG RYTCIAGNSC NIKHTEAPLY VVDKPVPEES EGPGSPPPYK
710 720 730 740 750
MIQTIGLSVG AAVAYIIAVL GLMFYCKKRC KAKRLQKQPE GEEPEMECLN
760 770 780 790 800
GGPLQNGQPS AEIQEEVALT SLGSGPAATN KRHSTSDKMH FPRSSLQPIT
810 820 830 840 850
TLGKSEFGEV FLAKAQGLEE GVAETLVLVK SLQSKDEQQQ LDFRRELEMF
860 870 880 890 900
GKLNHANVVR LLGLCREAEP HYMVLEYVDL GDLKQFLRIS KSKDEKLKSQ
910 920 930 940 950
PLSTKQKVAL CTQVALGMEH LSNNRFVHKD LAARNCLVSA QRQVKVSALG
960 970 980 990 1000
LSKDVYNSEY YHFRQAWVPL RWMSPEAILE GDFSTKSDVW AFGVLMWEVF
1010 1020 1030 1040 1050
THGEMPHGGQ ADDEVLADLQ AGKARLPQPE GCPSKLYRLM QRCWALSPKD
1060 1070
RPSFSEIASA LGDSTVDSKP
Length:1,070
Mass (Da):118,392
Last modified:October 17, 2006 - v2
Checksum:i304926A1774EB5F4
GO
Isoform 2 (identifier: Q13308-2) [UniParc]FASTAAdd to basket
Also known as: PTK7-2

The sequence of this isoform differs from the canonical sequence as follows:
     500-539: Missing.

Show »
Length:1,030
Mass (Da):113,805
Checksum:i34501D254ED02C49
GO
Isoform 3 (identifier: Q13308-3) [UniParc]FASTAAdd to basket
Also known as: PTK7-3

The sequence of this isoform differs from the canonical sequence as follows:
     410-540: TVPSWLKKPQ...KPTIKWERAD → N

Show »
Length:940
Mass (Da):103,581
Checksum:i33FEE51123972DA8
GO
Isoform 4 (identifier: Q13308-4) [UniParc]FASTAAdd to basket
Also known as: PTK7-4

The sequence of this isoform differs from the canonical sequence as follows:
     627-682: Missing.

Show »
Length:1,014
Mass (Da):112,261
Checksum:iBCAA8FEBBF9909B8
GO
Isoform 5 (identifier: Q13308-5) [UniParc]FASTAAdd to basket
Also known as: PTK7-5

The sequence of this isoform differs from the canonical sequence as follows:
     804-816: KSEFGEVFLAKAQ → RPQAVPEDFQEQG
     817-1070: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:816
Mass (Da):89,764
Checksum:i20405B0B94CA99EB
GO
Isoform 6 (identifier: Q13308-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGAARGSPARPRRLPLLSVLLLPLLG → MGSFLSGEKRPSAPTVGSAMEKKEFPTPPGRVGP

Note: No experimental confirmation available.
Show »
Length:1,078
Mass (Da):119,197
Checksum:iE5F3E9970734EAF8
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JQR6C9JQR6_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
257Annotation score:
H0Y8F1H0Y8F1_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
365Annotation score:
H7C5L0H7C5L0_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
269Annotation score:
Q86X91Q86X91_HUMAN
Inactive tyrosine-protein kinase 7
PTK7 CCK4
459Annotation score:
C9J9E8C9J9E8_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
139Annotation score:
F8WDG7F8WDG7_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
157Annotation score:
F8WCI7F8WCI7_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
84Annotation score:
H0Y889H0Y889_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
25Annotation score:
H7C4X3H7C4X3_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
25Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti87F → L in BAF85278 (PubMed:14702039).Curated1
Sequence conflicti92R → P in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti93L → P in AAH71557 (PubMed:15489334).Curated1
Sequence conflicti147T → K in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti207G → S in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti495 – 496RV → VL in AAA87565 (PubMed:7478540).Curated2
Sequence conflicti515E → G in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti755Q → R in BAH12463 (PubMed:14702039).Curated1
Sequence conflicti799I → F in BAF85278 (PubMed:14702039).Curated1
Sequence conflicti881G → E in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti969P → A in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti992F → S in AAA87565 (PubMed:7478540).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_041502276R → H1 PublicationCorresponds to variant dbSNP:rs56188167Ensembl.1
Natural variantiVAR_041503410T → S1 PublicationCorresponds to variant dbSNP:rs34021075Ensembl.1
Natural variantiVAR_041504745E → D1 PublicationCorresponds to variant dbSNP:rs9472017Ensembl.1
Natural variantiVAR_041505766E → Q1 PublicationCorresponds to variant dbSNP:rs56216742Ensembl.1
Natural variantiVAR_041506777A → V1 PublicationCorresponds to variant dbSNP:rs34764696Ensembl.1
Natural variantiVAR_041507783H → R1 PublicationCorresponds to variant dbSNP:rs55820547Ensembl.1
Natural variantiVAR_041508933A → V in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_0415091029P → T1 PublicationCorresponds to variant dbSNP:rs55755163Ensembl.1
Natural variantiVAR_0415101038R → Q1 PublicationCorresponds to variant dbSNP:rs34865794Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447751 – 26MGAAR…LPLLG → MGSFLSGEKRPSAPTVGSAM EKKEFPTPPGRVGP in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_037181410 – 540TVPSW…WERAD → N in isoform 3. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_037182500 – 539Missing in isoform 2. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_037183627 – 682Missing in isoform 4. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_037184804 – 816KSEFG…LAKAQ → RPQAVPEDFQEQG in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_037185817 – 1070Missing in isoform 5. 1 PublicationAdd BLAST254

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U33635 mRNA Translation: AAA87565.1
U40271 mRNA Translation: AAC50484.2
AF447176
, AF447157, AF447158, AF447162, AF447164, AF447167, AF447170, AF447171, AF447173, AF447174, AF447175 Genomic DNA Translation: AAL39062.1
AF531868 mRNA Translation: AAN04862.1
AF531869 mRNA Translation: AAN04863.1
AF531870 mRNA Translation: AAN04864.1
AF531871 mRNA Translation: AAN04865.1
AF531872 mRNA Translation: AAN04866.1
AK291016 mRNA Translation: BAF83705.1
AK292589 mRNA Translation: BAF85278.1
AK296953 mRNA Translation: BAH12463.1
AL355385 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04154.1
CH471081 Genomic DNA Translation: EAX04155.1
CH471081 Genomic DNA Translation: EAX04156.1
CH471081 Genomic DNA Translation: EAX04158.1
CH471081 Genomic DNA Translation: EAX04160.1
BC071557 mRNA Translation: AAH71557.1
CCDSiCCDS4884.1 [Q13308-1]
CCDS4885.1 [Q13308-2]
CCDS4886.1 [Q13308-3]
CCDS4887.1 [Q13308-4]
CCDS59021.1 [Q13308-6]
PIRiJC4593
RefSeqiNP_001257327.1, NM_001270398.1 [Q13308-6]
NP_002812.2, NM_002821.4 [Q13308-1]
NP_690619.1, NM_152880.3 [Q13308-2]
NP_690620.1, NM_152881.3 [Q13308-3]
NP_690621.1, NM_152882.3 [Q13308-4]
UniGeneiHs.90572

Genome annotation databases

EnsembliENST00000230418; ENSP00000230418; ENSG00000112655 [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655 [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655 [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655 [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655 [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655 [Q13308-6]
GeneIDi5754
KEGGihsa:5754
UCSCiuc003oub.3 human [Q13308-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U33635 mRNA Translation: AAA87565.1
U40271 mRNA Translation: AAC50484.2
AF447176
, AF447157, AF447158, AF447162, AF447164, AF447167, AF447170, AF447171, AF447173, AF447174, AF447175 Genomic DNA Translation: AAL39062.1
AF531868 mRNA Translation: AAN04862.1
AF531869 mRNA Translation: AAN04863.1
AF531870 mRNA Translation: AAN04864.1
AF531871 mRNA Translation: AAN04865.1
AF531872 mRNA Translation: AAN04866.1
AK291016 mRNA Translation: BAF83705.1
AK292589 mRNA Translation: BAF85278.1
AK296953 mRNA Translation: BAH12463.1
AL355385 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04154.1
CH471081 Genomic DNA Translation: EAX04155.1
CH471081 Genomic DNA Translation: EAX04156.1
CH471081 Genomic DNA Translation: EAX04158.1
CH471081 Genomic DNA Translation: EAX04160.1
BC071557 mRNA Translation: AAH71557.1
CCDSiCCDS4884.1 [Q13308-1]
CCDS4885.1 [Q13308-2]
CCDS4886.1 [Q13308-3]
CCDS4887.1 [Q13308-4]
CCDS59021.1 [Q13308-6]
PIRiJC4593
RefSeqiNP_001257327.1, NM_001270398.1 [Q13308-6]
NP_002812.2, NM_002821.4 [Q13308-1]
NP_690619.1, NM_152880.3 [Q13308-2]
NP_690620.1, NM_152881.3 [Q13308-3]
NP_690621.1, NM_152882.3 [Q13308-4]
UniGeneiHs.90572

3D structure databases

ProteinModelPortaliQ13308
SMRiQ13308
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111721, 45 interactors
IntActiQ13308, 18 interactors
MINTiQ13308
STRINGi9606.ENSP00000230419

PTM databases

GlyConnecti655
iPTMnetiQ13308
PhosphoSitePlusiQ13308
SwissPalmiQ13308
UniCarbKBiQ13308

Polymorphism and mutation databases

BioMutaiPTK7
DMDMi116242736

Proteomic databases

EPDiQ13308
MaxQBiQ13308
PaxDbiQ13308
PeptideAtlasiQ13308
PRIDEiQ13308
ProteomicsDBi59293
59294 [Q13308-2]
59295 [Q13308-3]
59296 [Q13308-4]
59297 [Q13308-5]
TopDownProteomicsiQ13308-3 [Q13308-3]

Protocols and materials databases

DNASUi5754
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000230418; ENSP00000230418; ENSG00000112655 [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655 [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655 [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655 [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655 [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655 [Q13308-6]
GeneIDi5754
KEGGihsa:5754
UCSCiuc003oub.3 human [Q13308-1]

Organism-specific databases

CTDi5754
DisGeNETi5754
EuPathDBiHostDB:ENSG00000112655.15
GeneCardsiPTK7
HGNCiHGNC:9618 PTK7
HPAiHPA003222
MIMi601890 gene
neXtProtiNX_Q13308
OpenTargetsiENSG00000112655
PharmGKBiPA33961
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1026 Eukaryota
KOG4475 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00760000118818
HOGENOMiHOG000115767
HOVERGENiHBG008320
InParanoidiQ13308
KOiK05127
OMAiGISHKGV
OrthoDBiEOG091G0BWE
PhylomeDBiQ13308
TreeFamiTF326835

Enzyme and pathway databases

SIGNORiQ13308

Miscellaneous databases

ChiTaRSiPTK7 human
GeneWikiiPTK7
GenomeRNAii5754
PROiPR:Q13308
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000112655 Expressed in 147 organ(s), highest expression level in myometrium
CleanExiHS_PTK7
ExpressionAtlasiQ13308 baseline and differential
GenevisibleiQ13308 HS

Family and domain databases

Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR033592 PTK7
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008266 Tyr_kinase_AS
PANTHERiPTHR26391:SF15 PTHR26391:SF15, 2 hits
PfamiView protein in Pfam
PF07679 I-set, 3 hits
PF07714 Pkinase_Tyr, 1 hit
PRINTSiPR00109 TYRKINASE
SMARTiView protein in SMART
SM00409 IG, 7 hits
SM00408 IGc2, 7 hits
SUPFAMiSSF48726 SSF48726, 7 hits
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 7 hits
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPTK7_HUMAN
AccessioniPrimary (citable) accession number: Q13308
Secondary accession number(s): A8K974
, B7Z477, E9PFZ5, Q13417, Q5T650, Q6IQ54, Q8NFA5, Q8NFA6, Q8NFA7, Q8NFA8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 17, 2006
Last modified: November 7, 2018
This is version 184 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again