Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13308 (PTK7_HUMAN)

Entry version 198 (12 Aug 2020)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Inactive tyrosine-protein kinase 7

Gene

PTK7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processCell adhesion, Wnt signaling pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q13308

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q13308

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Inactive tyrosine-protein kinase 7
Alternative name(s):
Colon carcinoma kinase 4
Short name:
CCK-4
Protein-tyrosine kinase 7
Pseudo tyrosine kinase receptor 7
Tyrosine-protein kinase-like 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTK7
Synonyms:CCK4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000112655.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:9618, PTK7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601890, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13308

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini31 – 704ExtracellularSequence analysisAdd BLAST674
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei705 – 725HelicalSequence analysisAdd BLAST21
Topological domaini726 – 1070CytoplasmicSequence analysisAdd BLAST345

Keywords - Cellular componenti

Cell junction, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi622L → D: Prevents proteolysis by MMP14. 1 Publication1
Mutagenesisi641M → R: No impact on proteolysis by MMP14. 1 Publication1
Mutagenesisi701M → D: No impact on proteolysis by MMP14. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5754

Open Targets

More...OpenTargetsi		ENSG00000112655

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33961

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13308, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PTK7

Domain mapping of disease mutations (DMDM)

More...DMDMi		116242736

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001674831 – 1070Inactive tyrosine-protein kinase 7Add BLAST1040

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi53 ↔ 101PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi116N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi150 ↔ 200PROSITE-ProRule annotation
Glycosylationi175N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi214N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi246 ↔ 301PROSITE-ProRule annotation
Glycosylationi268N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi283N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi343 ↔ 391PROSITE-ProRule annotation
Glycosylationi405N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi433 ↔ 481PROSITE-ProRule annotation
Glycosylationi463N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi524 ↔ 570PROSITE-ProRule annotation
Glycosylationi567N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi613 ↔ 664PROSITE-ProRule annotation
Glycosylationi646N-linked (GlcNAc...) asparagine2 Publications1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1064PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

MMP14 cleaves PTK7 between Pro-621 and Leu-622 generating an N-terminal soluble (70 kDa) fragment and a membrane C-terminal (50 kDa) fragment. Proteolysis by MMP14 regulates PTK7 function in non-canonical Wnt signaling pathway.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei621 – 622Cleavage; by MMP142

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q13308

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q13308

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q13308

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q13308

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13308

PeptideAtlas

More...PeptideAtlasi		Q13308

PRoteomics IDEntifications database

More...PRIDEi		Q13308

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		20212
59293 [Q13308-1]
59294 [Q13308-2]
59295 [Q13308-3]
59296 [Q13308-4]
59297 [Q13308-5]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q13308-3 [Q13308-3]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		655, 40 N-Linked glycans (6 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q13308, 10 sites, 7 N-linked glycans (3 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13308

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q13308

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13308

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q13308

UniCarbKB; an annotated and curated database of glycan structures

More...UniCarbKBi		Q13308

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Higher expression in cell lines established from normal non-tumorigenic tissues compared to cell lines established from highly metastatic invasive carcinomas (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000112655, Expressed in stromal cell of endometrium and 164 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13308, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13308, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000112655, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CTNNB1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111721, 54 interactors

Protein interaction database and analysis system

More...IntActi		Q13308, 51 interactors

Molecular INTeraction database

More...MINTi		Q13308

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000418754

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q13308, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13308

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 120Ig-like C2-type 1Add BLAST90
Domaini128 – 218Ig-like C2-type 2Add BLAST91
Domaini225 – 317Ig-like C2-type 3Add BLAST93
Domaini309 – 407Ig-like C2-type 4Add BLAST99
Domaini412 – 497Ig-like C2-type 5Add BLAST86
Domaini503 – 586Ig-like C2-type 6Add BLAST84
Domaini578 – 680Ig-like C2-type 7Add BLAST103
Domaini796 – 1066Protein kinase; inactivePROSITE-ProRule annotationAdd BLAST271

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni794 – 1070Interaction with CTNNB11 PublicationAdd BLAST277

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The protein kinase domain is predicted to be catalytically inactive.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1026, Eukaryota
KOG4475, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157908

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012268_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13308

KEGG Orthology (KO)

More...KOi		K05127

Identification of Orthologs from Complete Genome Data

More...OMAi		MWWEHAG

Database of Orthologous Groups

More...OrthoDBi		530072at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q13308

TreeFam database of animal gene trees

More...TreeFami		TF326835

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 7 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008266, Tyr_kinase_AS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07679, I-set, 3 hits
PF07714, Pkinase_Tyr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00109, TYRKINASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409, IG, 7 hits
SM00408, IGc2, 7 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 7 hits
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 7 hits
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00109, PROTEIN_KINASE_TYR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13308-1) [UniParc]FASTAAdd to basket
Also known as: PTK7-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAARGSPAR PRRLPLLSVL LLPLLGGTQT AIVFIKQPSS QDALQGRRAL 
        60         70         80         90        100
LRCEVEAPGP VHVYWLLDGA PVQDTERRFA QGSSLSFAAV DRLQDSGTFQ 
       110        120        130        140        150
CVARDDVTGE EARSANASFN IKWIEAGPVV LKHPASEAEI QPQTQVTLRC 
       160        170        180        190        200
HIDGHPRPTY QWFRDGTPLS DGQSNHTVSS KERNLTLRPA GPEHSGLYSC 
       210        220        230        240        250
CAHSAFGQAC SSQNFTLSIA DESFARVVLA PQDVVVARYE EAMFHCQFSA 
       260        270        280        290        300
QPPPSLQWLF EDETPITNRS RPPHLRRATV FANGSLLLTQ VRPRNAGIYR 
       310        320        330        340        350
CIGQGQRGPP IILEATLHLA EIEDMPLFEP RVFTAGSEER VTCLPPKGLP 
       360        370        380        390        400
EPSVWWEHAG VRLPTHGRVY QKGHELVLAN IAESDAGVYT CHAANLAGQR 
       410        420        430        440        450
RQDVNITVAT VPSWLKKPQD SQLEEGKPGY LDCLTQATPK PTVVWYRNQM 
       460        470        480        490        500
LISEDSRFEV FKNGTLRINS VEVYDGTWYR CMSSTPAGSI EAQARVQVLE 
       510        520        530        540        550
KLKFTPPPQP QQCMEFDKEA TVPCSATGRE KPTIKWERAD GSSLPEWVTD 
       560        570        580        590        600
NAGTLHFARV TRDDAGNYTC IASNGPQGQI RAHVQLTVAV FITFKVEPER 
       610        620        630        640        650
TTVYQGHTAL LQCEAQGDPK PLIQWKGKDR ILDPTKLGPR MHIFQNGSLV 
       660        670        680        690        700
IHDVAPEDSG RYTCIAGNSC NIKHTEAPLY VVDKPVPEES EGPGSPPPYK 
       710        720        730        740        750
MIQTIGLSVG AAVAYIIAVL GLMFYCKKRC KAKRLQKQPE GEEPEMECLN 
       760        770        780        790        800
GGPLQNGQPS AEIQEEVALT SLGSGPAATN KRHSTSDKMH FPRSSLQPIT 
       810        820        830        840        850
TLGKSEFGEV FLAKAQGLEE GVAETLVLVK SLQSKDEQQQ LDFRRELEMF 
       860        870        880        890        900
GKLNHANVVR LLGLCREAEP HYMVLEYVDL GDLKQFLRIS KSKDEKLKSQ 
       910        920        930        940        950
PLSTKQKVAL CTQVALGMEH LSNNRFVHKD LAARNCLVSA QRQVKVSALG 
       960        970        980        990       1000
LSKDVYNSEY YHFRQAWVPL RWMSPEAILE GDFSTKSDVW AFGVLMWEVF 
      1010       1020       1030       1040       1050
THGEMPHGGQ ADDEVLADLQ AGKARLPQPE GCPSKLYRLM QRCWALSPKD 
      1060       1070
RPSFSEIASA LGDSTVDSKP
Length:1,070
Mass (Da):118,392
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i304926A1774EB5F4
GO
Isoform 2 (identifier: Q13308-2) [UniParc]FASTAAdd to basket
Also known as: PTK7-2

The sequence of this isoform differs from the canonical sequence as follows:
     500-539: Missing.

Show »
Length:1,030
Mass (Da):113,805
Checksum:i34501D254ED02C49
GO
Isoform 3 (identifier: Q13308-3) [UniParc]FASTAAdd to basket
Also known as: PTK7-3

The sequence of this isoform differs from the canonical sequence as follows:
     410-540: TVPSWLKKPQ...KPTIKWERAD → N

Show »
Length:940
Mass (Da):103,581
Checksum:i33FEE51123972DA8
GO
Isoform 4 (identifier: Q13308-4) [UniParc]FASTAAdd to basket
Also known as: PTK7-4

The sequence of this isoform differs from the canonical sequence as follows:
     627-682: Missing.

Show »
Length:1,014
Mass (Da):112,261
Checksum:iBCAA8FEBBF9909B8
GO
Isoform 5 (identifier: Q13308-5) [UniParc]FASTAAdd to basket
Also known as: PTK7-5

The sequence of this isoform differs from the canonical sequence as follows:
     804-816: KSEFGEVFLAKAQ → RPQAVPEDFQEQG
     817-1070: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:816
Mass (Da):89,764
Checksum:i20405B0B94CA99EB
GO
Isoform 6 (identifier: Q13308-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGAARGSPARPRRLPLLSVLLLPLLG → MGSFLSGEKRPSAPTVGSAMEKKEFPTPPGRVGP

Show »
Length:1,078
Mass (Da):119,197
Checksum:iE5F3E9970734EAF8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JQR6C9JQR6_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
257Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8F1H0Y8F1_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
365Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q86X91Q86X91_HUMAN
Inactive tyrosine-protein kinase 7
PTK7 CCK4
459Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCI7F8WCI7_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J9E8C9J9E8_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDG7F8WDG7_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5L0H7C5L0_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
269Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4X3H7C4X3_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y889H0Y889_HUMAN
Inactive tyrosine-protein kinase 7
PTK7
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti87F → L in BAF85278 (PubMed:14702039).Curated1
Sequence conflicti92R → P in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti93L → P in AAH71557 (PubMed:15489334).Curated1
Sequence conflicti147T → K in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti207G → S in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti495 – 496RV → VL in AAA87565 (PubMed:7478540).Curated2
Sequence conflicti515E → G in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti755Q → R in BAH12463 (PubMed:14702039).Curated1
Sequence conflicti799I → F in BAF85278 (PubMed:14702039).Curated1
Sequence conflicti881G → E in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti969P → A in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti992F → S in AAA87565 (PubMed:7478540).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_041502276R → H1 PublicationCorresponds to variant dbSNP:rs56188167Ensembl.1
Natural variantiVAR_041503410T → S1 PublicationCorresponds to variant dbSNP:rs34021075Ensembl.1
Natural variantiVAR_041504745E → D1 PublicationCorresponds to variant dbSNP:rs9472017Ensembl.1
Natural variantiVAR_041505766E → Q1 PublicationCorresponds to variant dbSNP:rs56216742Ensembl.1
Natural variantiVAR_041506777A → V1 PublicationCorresponds to variant dbSNP:rs34764696Ensembl.1
Natural variantiVAR_041507783H → R1 PublicationCorresponds to variant dbSNP:rs55820547Ensembl.1
Natural variantiVAR_041508933A → V in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_0415091029P → T1 PublicationCorresponds to variant dbSNP:rs55755163Ensembl.1
Natural variantiVAR_0415101038R → Q1 PublicationCorresponds to variant dbSNP:rs34865794Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0447751 – 26MGAAR…LPLLG → MGSFLSGEKRPSAPTVGSAM EKKEFPTPPGRVGP in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_037181410 – 540TVPSW…WERAD → N in isoform 3. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_037182500 – 539Missing in isoform 2. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_037183627 – 682Missing in isoform 4. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_037184804 – 816KSEFG…LAKAQ → RPQAVPEDFQEQG in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_037185817 – 1070Missing in isoform 5. 1 PublicationAdd BLAST254

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U33635 mRNA Translation: AAA87565.1
U40271 mRNA Translation: AAC50484.2
AF447176 AF447175 Genomic DNA Translation: AAL39062.1
AF531868 mRNA Translation: AAN04862.1
AF531869 mRNA Translation: AAN04863.1
AF531870 mRNA Translation: AAN04864.1
AF531871 mRNA Translation: AAN04865.1
AF531872 mRNA Translation: AAN04866.1
AK291016 mRNA Translation: BAF83705.1
AK292589 mRNA Translation: BAF85278.1
AK296953 mRNA Translation: BAH12463.1
AL355385 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04154.1
CH471081 Genomic DNA Translation: EAX04155.1
CH471081 Genomic DNA Translation: EAX04156.1
CH471081 Genomic DNA Translation: EAX04158.1
CH471081 Genomic DNA Translation: EAX04160.1
BC071557 mRNA Translation: AAH71557.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4884.1 [Q13308-1]
CCDS4885.1 [Q13308-2]
CCDS4886.1 [Q13308-3]
CCDS4887.1 [Q13308-4]
CCDS59021.1 [Q13308-6]

Protein sequence database of the Protein Information Resource

More...PIRi		JC4593

NCBI Reference Sequences

More...RefSeqi		NP_001257327.1, NM_001270398.1 [Q13308-6]
NP_002812.2, NM_002821.4 [Q13308-1]
NP_690619.1, NM_152880.3 [Q13308-2]
NP_690620.1, NM_152881.3 [Q13308-3]
NP_690621.1, NM_152882.3 [Q13308-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000230418; ENSP00000230418; ENSG00000112655 [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655 [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655 [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655 [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655 [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655 [Q13308-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5754

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5754

UCSC genome browser

More...UCSCi		uc003oub.3, human [Q13308-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U33635 mRNA Translation: AAA87565.1
U40271 mRNA Translation: AAC50484.2
AF447176 AF447175 Genomic DNA Translation: AAL39062.1
AF531868 mRNA Translation: AAN04862.1
AF531869 mRNA Translation: AAN04863.1
AF531870 mRNA Translation: AAN04864.1
AF531871 mRNA Translation: AAN04865.1
AF531872 mRNA Translation: AAN04866.1
AK291016 mRNA Translation: BAF83705.1
AK292589 mRNA Translation: BAF85278.1
AK296953 mRNA Translation: BAH12463.1
AL355385 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04154.1
CH471081 Genomic DNA Translation: EAX04155.1
CH471081 Genomic DNA Translation: EAX04156.1
CH471081 Genomic DNA Translation: EAX04158.1
CH471081 Genomic DNA Translation: EAX04160.1
BC071557 mRNA Translation: AAH71557.1
CCDSiCCDS4884.1 [Q13308-1]
CCDS4885.1 [Q13308-2]
CCDS4886.1 [Q13308-3]
CCDS4887.1 [Q13308-4]
CCDS59021.1 [Q13308-6]
PIRiJC4593
RefSeqiNP_001257327.1, NM_001270398.1 [Q13308-6]
NP_002812.2, NM_002821.4 [Q13308-1]
NP_690619.1, NM_152880.3 [Q13308-2]
NP_690620.1, NM_152881.3 [Q13308-3]
NP_690621.1, NM_152882.3 [Q13308-4]

3D structure databases

SMRiQ13308
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi111721, 54 interactors
IntActiQ13308, 51 interactors
MINTiQ13308
STRINGi9606.ENSP00000418754

PTM databases

GlyConnecti655, 40 N-Linked glycans (6 sites)
GlyGeniQ13308, 10 sites, 7 N-linked glycans (3 sites)
iPTMnetiQ13308
MetOSiteiQ13308
PhosphoSitePlusiQ13308
SwissPalmiQ13308
UniCarbKBiQ13308

Polymorphism and mutation databases

BioMutaiPTK7
DMDMi116242736

Proteomic databases

EPDiQ13308
jPOSTiQ13308
MassIVEiQ13308
MaxQBiQ13308
PaxDbiQ13308
PeptideAtlasiQ13308
PRIDEiQ13308
ProteomicsDBi20212
59293 [Q13308-1]
59294 [Q13308-2]
59295 [Q13308-3]
59296 [Q13308-4]
59297 [Q13308-5]
TopDownProteomicsiQ13308-3 [Q13308-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q13308, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1008, 579 antibodies

The DNASU plasmid repository

More...DNASUi		5754

Genome annotation databases

EnsembliENST00000230418; ENSP00000230418; ENSG00000112655 [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655 [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655 [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655 [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655 [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655 [Q13308-6]
GeneIDi5754
KEGGihsa:5754
UCSCiuc003oub.3, human [Q13308-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5754
DisGeNETi5754
EuPathDBiHostDB:ENSG00000112655.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		PTK7
HGNCiHGNC:9618, PTK7
HPAiENSG00000112655, Low tissue specificity
MIMi601890, gene
neXtProtiNX_Q13308
OpenTargetsiENSG00000112655
PharmGKBiPA33961

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1026, Eukaryota
KOG4475, Eukaryota
GeneTreeiENSGT00940000157908
HOGENOMiCLU_012268_0_0_1
InParanoidiQ13308
KOiK05127
OMAiMWWEHAG
OrthoDBi530072at2759
PhylomeDBiQ13308
TreeFamiTF326835

Enzyme and pathway databases

PathwayCommonsiQ13308
SIGNORiQ13308

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5754, 10 hits in 911 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PTK7, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PTK7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5754
PharosiQ13308, Tbio

Protein Ontology

More...PROi		PR:Q13308
RNActiQ13308, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000112655, Expressed in stromal cell of endometrium and 164 other tissues
ExpressionAtlasiQ13308, baseline and differential
GenevisibleiQ13308, HS

Family and domain databases

Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008266, Tyr_kinase_AS
PfamiView protein in Pfam
PF07679, I-set, 3 hits
PF07714, Pkinase_Tyr, 1 hit
PRINTSiPR00109, TYRKINASE
SMARTiView protein in SMART
SM00409, IG, 7 hits
SM00408, IGc2, 7 hits
SUPFAMiSSF48726, SSF48726, 7 hits
SSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 7 hits
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00109, PROTEIN_KINASE_TYR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTK7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13308
Secondary accession number(s): A8K974
, B7Z477, E9PFZ5, Q13417, Q5T650, Q6IQ54, Q8NFA5, Q8NFA6, Q8NFA7, Q8NFA8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 17, 2006
Last modified: August 12, 2020
This is version 198 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again