Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-15 receptor subunit alpha

Gene

IL15RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cytokine receptor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8983432 Interleukin-15 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q13261

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q13261

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-15 receptor subunit alpha
Short name:
IL-15 receptor subunit alpha
Short name:
IL-15R-alpha
Short name:
IL-15RA
Alternative name(s):
CD_antigen: CD215
Cleaved into the following chain:
Soluble interleukin-15 receptor subunit alpha
Short name:
sIL-15 receptor subunit alpha
Short name:
sIL-15R-alpha
Short name:
sIL-15RA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL15RA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000134470.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5978 IL15RA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601070 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q13261

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini31 – 205ExtracellularSequence analysisAdd BLAST175
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei206 – 228HelicalSequence analysisAdd BLAST23
Topological domaini229 – 267CytoplasmicSequence analysisAdd BLAST39

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Membrane, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi227Y → F: Abrogates association with SYK and phosphorylation upon IL-15 stimulation. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
3601

Open Targets

More...
OpenTargetsi
ENSG00000134470

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29791

Chemistry databases

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1702

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IL15RA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
59799763

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001104431 – 267Interleukin-15 receptor subunit alphaAdd BLAST237
ChainiPRO_000033385531 – ?Soluble interleukin-15 receptor subunit alpha

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi33 ↔ 75
Disulfide bondi59 ↔ 93
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi137N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

A soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE (By similarity). It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor.By similarity1 Publication
Phosphorylated by activated SYK.1 Publication
N-glycosylated and O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q13261

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q13261

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q13261

PeptideAtlas

More...
PeptideAtlasi
Q13261

PRoteomics IDEntifications database

More...
PRIDEi
Q13261

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59258
59259 [Q13261-3]
59260 [Q13261-4]
59261 [Q13261-5]
59262 [Q13261-6]
59263 [Q13261-7]
59264 [Q13261-8]
59265 [Q13261-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q13261

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q13261

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134470 Expressed in 158 organ(s), highest expression level in ectocervix

CleanEx database of gene expression profiles

More...
CleanExi
HS_IL15RA

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q13261 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q13261 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB026215

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The interleukin-15 receptor IL15R is a heterotrimer of IL15RA, IL2RB and IL2RG. IL15RA also self-associates (By similarity). Interacts with SYK.By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
IL15P409335EBI-980354,EBI-980274

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109814, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q13261, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369312

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1267
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ERSNMR-A31-96[»]
2Z3QX-ray1.85B/D31-132[»]
2Z3RX-ray2.00B/D/F/H/J/L/N/P31-132[»]
4GS7X-ray2.35D30-97[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q13261

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q13261

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q13261

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 95SushiPROSITE-ProRule annotationAdd BLAST65

Keywords - Domaini

Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWP4 Eukaryota
ENOG410Z8MM LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000121

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000036788

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052061

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q13261

KEGG Orthology (KO)

More...
KOi
K05074

Database of Orthologous Groups

More...
OrthoDBi
1326471at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q13261

TreeFam database of animal gene trees

More...
TreeFami
TF338443

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00033 CCP, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00032 CCP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57535 SSF57535, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50923 SUSHI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13261-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS
60 70 80 90 100
LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV
110 120 130 140 150
HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS
160 170 180 190 200
QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG
210 220 230 240 250
HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE MEAMEALPVT
260
WGTSSRDEDL ENCSHHL
Length:267
Mass (Da):28,233
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA9CFC885189E96BE
GO
Isoform 2 (identifier: Q13261-3) [UniParc]FASTAAdd to basket
Also known as: delta3E1E7Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K

Show »
Length:234
Mass (Da):24,870
Checksum:i9ACAD3E117A8C9AF
GO
Isoform 3 (identifier: Q13261-4) [UniParc]FASTAAdd to basket
Also known as: E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:252
Mass (Da):26,299
Checksum:iA58933D9E843EDC6
GO
Isoform 4 (identifier: Q13261-5) [UniParc]FASTAAdd to basket
Also known as: delta3E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:219
Mass (Da):22,936
Checksum:iDD564A227CB6AA3F
GO
Isoform 5 (identifier: Q13261-6) [UniParc]FASTAAdd to basket
Also known as: delta2E1E7Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     31-95: Missing.

Show »
Length:202
Mass (Da):20,904
Checksum:iD4F5DD2EA004C6D2
GO
Isoform 6 (identifier: Q13261-7) [UniParc]FASTAAdd to basket
Also known as: delta2E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     31-95: Missing.
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:187
Mass (Da):18,969
Checksum:iD7A5B6202C329FB0
GO
Isoform 7 (identifier: Q13261-8) [UniParc]FASTAAdd to basket
Also known as: delta2deltaE1E73Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     30-127: Missing.

Show »
Length:169
Mass (Da):17,641
Checksum:i238A6ECC5B7675A1
GO
Isoform 8 (identifier: Q13261-9) [UniParc]FASTAAdd to basket
Also known as: delta2delta3E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     30-127: Missing.
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:154
Mass (Da):15,707
Checksum:i23F224FD25881D2C
GO
Isoform 9 (identifier: Q13261-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Note: No experimental confirmation available.
Show »
Length:231
Mass (Da):24,388
Checksum:i85A770AB71977219
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K9N2Q6K9N2Q6_HUMAN
Interleukin 15 receptor alpha isofo...
IL15RA il15ra
346Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K9N1J3K9N1J3_HUMAN
Interleukin 15 receptor alpha isofo...
IL15RA il15ra
308Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K9N2S2K9N2S2_HUMAN
Interleukin 15 receptor alpha isofo...
IL15RA il15ra
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K9N163K9N163_HUMAN
Interleukin 15 receptor alpha isofo...
IL15RA il15ra
331Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD11H0YD11_HUMAN
Interleukin-15 receptor subunit alp...
IL15RA
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQ64E9PQ64_HUMAN
Interleukin-15 receptor subunit alp...
IL15RA
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4R3H0Y4R3_HUMAN
Interleukin-15 receptor subunit alp...
IL15RA
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MS77A0A0A0MS77_HUMAN
Interleukin-15 receptor subunit alp...
IL15RA
353Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JVA3Q5JVA3_HUMAN
Interleukin-15 receptor subunit alp...
IL15RA
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ETI1E7ETI1_HUMAN
Interleukin-15 receptor subunit alp...
IL15RA
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB88175 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAW86419 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti200G → D in AAH74726 (PubMed:9110174).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020967182N → T3 PublicationsCorresponds to variant dbSNP:rs2228059Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0554061 – 36Missing in isoform 9. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_01262330 – 127Missing in isoform 7 and isoform 8. CuratedAdd BLAST98
Alternative sequenceiVSP_01262431 – 95Missing in isoform 5 and isoform 6. CuratedAdd BLAST65
Alternative sequenceiVSP_01262595 – 128RDPAL…PSGKE → K in isoform 2 and isoform 4. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_012626232 – 267QTPPL…CSHHL → ASVCSCHPRSAGHTCSVGSV C in isoform 3, isoform 4, isoform 6 and isoform 8. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U31628 mRNA Translation: AAC50312.1
CR457064 mRNA Translation: CAG33345.1
CR542023 mRNA Translation: CAG46820.1
AY316538 Genomic DNA Translation: AAP69528.1
AK304211 mRNA Translation: BAG65084.1
AL137186 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86417.1
CH471072 Genomic DNA Translation: EAW86418.1
CH471072 Genomic DNA Translation: EAW86419.1 Sequence problems.
BC074726 mRNA Translation: AAH74726.1
BC107777 mRNA Translation: AAI07778.1
BC121140 mRNA Translation: AAI21141.1
BC121141 mRNA Translation: AAI21142.1
AF035279 mRNA Translation: AAB88175.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58069.1 [Q13261-10]
CCDS7074.1 [Q13261-1]
CCDS7075.2 [Q13261-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001230468.1, NM_001243539.1 [Q13261-10]
NP_001243694.1, NM_001256765.1
NP_002180.1, NM_002189.3 [Q13261-1]
NP_751950.2, NM_172200.2 [Q13261-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.445124

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000379971; ENSP00000369306; ENSG00000134470 [Q13261-9]
ENST00000379977; ENSP00000369312; ENSG00000134470 [Q13261-1]
ENST00000397250; ENSP00000380422; ENSG00000134470 [Q13261-8]
ENST00000397255; ENSP00000380426; ENSG00000134470 [Q13261-4]
ENST00000525219; ENSP00000431529; ENSG00000134470 [Q13261-10]
ENST00000528354; ENSP00000435454; ENSG00000134470 [Q13261-3]
ENST00000530685; ENSP00000435995; ENSG00000134470 [Q13261-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3601

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3601

UCSC genome browser

More...
UCSCi
uc001iiv.4 human [Q13261-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U31628 mRNA Translation: AAC50312.1
CR457064 mRNA Translation: CAG33345.1
CR542023 mRNA Translation: CAG46820.1
AY316538 Genomic DNA Translation: AAP69528.1
AK304211 mRNA Translation: BAG65084.1
AL137186 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86417.1
CH471072 Genomic DNA Translation: EAW86418.1
CH471072 Genomic DNA Translation: EAW86419.1 Sequence problems.
BC074726 mRNA Translation: AAH74726.1
BC107777 mRNA Translation: AAI07778.1
BC121140 mRNA Translation: AAI21141.1
BC121141 mRNA Translation: AAI21142.1
AF035279 mRNA Translation: AAB88175.1 Different initiation.
CCDSiCCDS58069.1 [Q13261-10]
CCDS7074.1 [Q13261-1]
CCDS7075.2 [Q13261-3]
RefSeqiNP_001230468.1, NM_001243539.1 [Q13261-10]
NP_001243694.1, NM_001256765.1
NP_002180.1, NM_002189.3 [Q13261-1]
NP_751950.2, NM_172200.2 [Q13261-3]
UniGeneiHs.445124

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ERSNMR-A31-96[»]
2Z3QX-ray1.85B/D31-132[»]
2Z3RX-ray2.00B/D/F/H/J/L/N/P31-132[»]
4GS7X-ray2.35D30-97[»]
ProteinModelPortaliQ13261
SMRiQ13261
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109814, 8 interactors
IntActiQ13261, 9 interactors
STRINGi9606.ENSP00000369312

Chemistry databases

GuidetoPHARMACOLOGYi1702

PTM databases

iPTMnetiQ13261

Polymorphism and mutation databases

BioMutaiIL15RA
DMDMi59799763

Proteomic databases

jPOSTiQ13261
MaxQBiQ13261
PaxDbiQ13261
PeptideAtlasiQ13261
PRIDEiQ13261
ProteomicsDBi59258
59259 [Q13261-3]
59260 [Q13261-4]
59261 [Q13261-5]
59262 [Q13261-6]
59263 [Q13261-7]
59264 [Q13261-8]
59265 [Q13261-9]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379971; ENSP00000369306; ENSG00000134470 [Q13261-9]
ENST00000379977; ENSP00000369312; ENSG00000134470 [Q13261-1]
ENST00000397250; ENSP00000380422; ENSG00000134470 [Q13261-8]
ENST00000397255; ENSP00000380426; ENSG00000134470 [Q13261-4]
ENST00000525219; ENSP00000431529; ENSG00000134470 [Q13261-10]
ENST00000528354; ENSP00000435454; ENSG00000134470 [Q13261-3]
ENST00000530685; ENSP00000435995; ENSG00000134470 [Q13261-5]
GeneIDi3601
KEGGihsa:3601
UCSCiuc001iiv.4 human [Q13261-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3601
DisGeNETi3601
EuPathDBiHostDB:ENSG00000134470.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IL15RA

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0035314
HGNCiHGNC:5978 IL15RA
HPAiCAB026215
MIMi601070 gene
neXtProtiNX_Q13261
OpenTargetsiENSG00000134470
PharmGKBiPA29791

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWP4 Eukaryota
ENOG410Z8MM LUCA
GeneTreeiENSGT00390000000121
HOGENOMiHOG000036788
HOVERGENiHBG052061
InParanoidiQ13261
KOiK05074
OrthoDBi1326471at2759
PhylomeDBiQ13261
TreeFamiTF338443

Enzyme and pathway databases

ReactomeiR-HSA-8983432 Interleukin-15 signaling
SignaLinkiQ13261
SIGNORiQ13261

Miscellaneous databases

EvolutionaryTraceiQ13261

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Interleukin_15_receptor,_alpha_subunit

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3601
PMAP-CutDBiQ13261

Protein Ontology

More...
PROi
PR:Q13261

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000134470 Expressed in 158 organ(s), highest expression level in ectocervix
CleanExiHS_IL15RA
ExpressionAtlasiQ13261 baseline and differential
GenevisibleiQ13261 HS

Family and domain databases

CDDicd00033 CCP, 1 hit
InterProiView protein in InterPro
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
SMARTiView protein in SMART
SM00032 CCP, 1 hit
SUPFAMiSSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS50923 SUSHI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiI15RA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13261
Secondary accession number(s): B4E2C2
, Q3B769, Q5JVA1, Q5JVA2, Q5JVA4, Q6B0J2, Q7LDR4, Q7Z609
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: November 1, 1996
Last modified: January 16, 2019
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again