KLRD1

Functionⁱ

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

GO - Molecular functionⁱ

carbohydrate binding Source: UniProtKB-KW
MHC class Ib protein binding, via antigen binding groove
Source: UniProtKB
Inferred from physical interactionⁱ
- 25631937
MHC class I protein complex binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 18448674
protein antigen binding
Source: UniProtKB
Inferred from direct assayⁱ
- 18448674
transmembrane signaling receptor activity
Source: ProtInc
Traceable author statementⁱ
- 7589107

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell surface receptor signaling pathway
Source: ProtInc
Traceable author statementⁱ
- 7589107
innate immune response Source: Reactome
natural killer cell mediated immunity
Source: UniProtKB
Inferred from direct assayⁱ
- 18448674
regulation of immune response Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Receptor
Ligand	Lectin

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell R-HSA-2172127 DAP12 interactions R-HSA-2424491 DAP12 signaling

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-2172127 DAP12 interactions
R-HSA-2424491 DAP12 signaling

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Natural killer cells antigen CD94 Alternative name(s): KP43 Killer cell lectin-like receptor subfamily D member 1 NK cell receptor CD_antigen: CD94
Gene namesⁱ	Name:KLRD1 Synonyms:CD94
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 12

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000134539.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:6378 KLRD1
MIMⁱ	602894 gene
neXtProtⁱ	NX_Q13241

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 10	CytoplasmicSequence analysis	10
Transmembraneⁱ	11 – 31	Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST	21
Topological domainⁱ	32 – 179	ExtracellularSequence analysisAdd BLAST	148

Keywords - Cellular componentⁱ

Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	3824
Open Targets More...OpenTargetsⁱ	ENSG00000134539
PharmGKBⁱ	PA30167

Polymorphism and mutation databases

BioMutaⁱ	KLRD1
DMDMⁱ	334302835

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000046587	1 – 179	Natural killer cells antigen CD94Add BLAST		179

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	58 ↔ 70	2 Publications
Disulfide bondⁱ	59	Interchain (with C-116 in NGK2A)2 Publications
Disulfide bondⁱ	61 ↔ 72	4 Publications
Glycosylationⁱ	83	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	89 ↔ 174	4 Publications
Glycosylationⁱ	132	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	152 ↔ 166	4 Publications

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbⁱ	Q13241
PeptideAtlas More...PeptideAtlasⁱ	Q13241
PRIDEⁱ	Q13241
ProteomicsDBⁱ	59243 59244 [Q13241-2] 59245 [Q13241-3]

PTM databases

iPTMnetⁱ	Q13241
PhosphoSitePlusⁱ	Q13241

Expressionⁱ

Tissue specificityⁱ

Natural killer cells.

Gene expression databases

Bgeeⁱ	ENSG00000134539 Expressed in 114 organ(s), highest expression level in leukocyte
CleanExⁱ	HS_KLRD1
ExpressionAtlasⁱ	Q13241 baseline and differential
Genevisibleⁱ	Q13241 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA069688

HPAⁱ

HPA069688

Interactionⁱ

Subunit structureⁱ

Can form disulfide-bonded heterodimer with NKG2 family members.3 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
KLRC1	P26715	5	EBI-9018174,EBI-9018187

With

Entry

#Exp.

IntAct

Notes

KLRC1

P26715

5

EBI-9018174,EBI-9018187

GO - Molecular functionⁱ

MHC class Ib protein binding, via antigen binding groove
Source: UniProtKB
Inferred from physical interactionⁱ
- 25631937
protein antigen binding
Source: UniProtKB
Inferred from direct assayⁱ
- 18448674

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	110023, 25 interactors
IntActⁱ	Q13241, 2 interactors
STRINGⁱ	9606.ENSP00000338130

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Turnⁱ	62 – 64	Combined sources	3
Beta strandⁱ	66 – 68	Combined sources	3
Beta strandⁱ	71 – 75	Combined sources	5
Helixⁱ	82 – 91	Combined sources	10
Helixⁱ	102 – 108	Combined sources	7
Beta strandⁱ	118 – 122	Combined sources	5
Turnⁱ	123 – 126	Combined sources	4
Beta strandⁱ	127 – 130	Combined sources	4
Turnⁱ	138 – 140	Combined sources	3
Helixⁱ	142 – 146	Combined sources	5
Beta strandⁱ	151 – 156	Combined sources	6
Turnⁱ	157 – 159	Combined sources	3
Beta strandⁱ	160 – 164	Combined sources	5
Beta strandⁱ	170 – 176	Combined sources	7

Show more details

3D structure databases

ProteinModelPortalⁱ	Q13241
SMRⁱ	Q13241
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q13241

EvolutionaryTraceⁱ

Q13241

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	68 – 175	C-type lectinPROSITE-ProRule annotationAdd BLAST		108

Keywords - Domainⁱ

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG4297 Eukaryota ENOG410XPJ1 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00730000110282
HOGENOMⁱ	HOG000220925
HOVERGENⁱ	HBG099800
InParanoidⁱ	Q13241
KEGG Orthology (KO) More...KOⁱ	K06516
OMAⁱ	YSEEHHA
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0RZF
TreeFamⁱ	TF336674

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd03593 CLECT_NK_receptors_like, 1 hit
Gene3Dⁱ	3.10.100.10, 1 hit
InterProⁱ	View protein in InterPro IPR001304 C-type_lectin-like IPR016186 C-type_lectin-like/link_sf IPR016187 CTDL_fold IPR033992 NKR-like_CTLD
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00059 Lectin_C, 1 hit
SMARTⁱ	View protein in SMART SM00034 CLECT, 1 hit
SUPFAMⁱ	SSF56436 SSF56436, 1 hit
PROSITEⁱ	View protein in PROSITE PS50041 C_TYPE_LECTIN_2, 1 hit

Sequences (3+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 3 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: Q13241-1) [UniParc]FASTA Add to basket

Also known as: CD94-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI 
        60         70         80         90        100
ELQKDSDCCS CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ 
       110        120        130        140        150
NTDELDFMSS SQQFYWIGLS YSEEHTAWLW ENGSALSQYL FPSFETFNTK 
       160        170 
NCIAYNPNGN ALDESCEDKN RYICKQQLI

Length:179

Mass (Da):20,513

Last modified:May 31, 2011 - v2

Checksum:ⁱ01634D3832D4B1A7

GO

Isoform 2 (identifier: Q13241-2) [UniParc]FASTA Add to basket

Also known as: CD94-B

The sequence of this isoform differs from the canonical sequence as follows:
105-105: L → LQ

« Hide

        10         20         30         40         50
MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI 
        60         70         80         90        100
ELQKDSDCCS CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ 
       110        120        130        140        150
NTDELQDFMS SSQQFYWIGL SYSEEHTAWL WENGSALSQY LFPSFETFNT 
       160        170        180
KNCIAYNPNG NALDESCEDK NRYICKQQLI

Show »

Length:180

Mass (Da):20,641

Checksum:ⁱ2913D0532DAFA866

GO

Isoform 3 (identifier: Q13241-3) [UniParc]FASTA Add to basket

Also known as: CD94 alt

The sequence of this isoform differs from the canonical sequence as follows:
1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA

« Hide

        10         20         30         40         50
MAAFTKLSIE PAFTPGPNIE LQKDSDCCSC QEKWVGYRCN CYFISSEQKT 
        60         70         80         90        100
WNESRHLCAS QKSSLLQLQN TDELDFMSSS QQFYWIGLSY SEEHTAWLWE 
       110        120        130        140 
NGSALSQYLF PSFETFNTKN CIAYNPNGNA LDESCEDKNR YICKQQLI

Show »

Length:148

Mass (Da):17,109

Checksum:ⁱ2C3876E8A2337B44

GO

Computationally mapped potential isoform sequencesⁱ

There are 5 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

F6WZH4	F6WZH4_HUMAN	Natural killer cells antigen CD94 Natural killer cells antigen CD94	KLRD1	158	Annotation score:
F5GX94	F5GX94_HUMAN	Natural killer cells antigen CD94 Natural killer cells antigen CD94	KLRD1	106	Annotation score:
E9PCX9	E9PCX9_HUMAN	Natural killer cells antigen CD94 Natural killer cells antigen CD94	KLRD1	72	Annotation score:
F5H2B7	F5H2B7_HUMAN	Natural killer cells antigen CD94 Natural killer cells antigen CD94	KLRD1	139	Annotation score:
H0YFB8	H0YFB8_HUMAN	Natural killer cells antigen CD94 Natural killer cells antigen CD94	KLRD1	51	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_050103	25	S → A3 PublicationsCorresponds to variant dbSNP:rs10772256Ensembl.		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_003052	1 – 34	MAVFK…LLKNS → MAA in isoform 3. 1 PublicationAdd BLAST		34
Alternative sequenceⁱVSP_003053	105	L → LQ in isoform 2. Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U30610 mRNA Translation: AAC50291.1 Y14287, Y14288 Genomic DNA Translation: CAA74663.1 AJ000673 Genomic DNA Translation: CAA04230.1 AJ000001 mRNA Translation: CAA03845.1 AB009597 mRNA Translation: BAA24450.1 AB010084 Genomic DNA Translation: BAA24451.1 AC022075 Genomic DNA No translation available. BC028009 mRNA Translation: AAH28009.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS8621.1 [Q13241-1] CCDS8622.1 [Q13241-3]
NCBI Reference Sequences More...RefSeqⁱ	NP_001107868.1, NM_001114396.1 [Q13241-1] NP_002253.1, NM_002262.3 [Q13241-1] NP_031360.1, NM_007334.2 [Q13241-3] XP_016874780.1, XM_017019291.1
UniGeneⁱ	Hs.562457

Genome annotation databases

Ensemblⁱ	ENST00000336164; ENSP00000338130; ENSG00000134539 [Q13241-1] ENST00000350274; ENSP00000310929; ENSG00000134539 [Q13241-3] ENST00000381908; ENSP00000371333; ENSG00000134539 [Q13241-1]
GeneIDⁱ	3824
KEGGⁱ	hsa:3824
UCSC genome browser More...UCSCⁱ	uc001qxw.5 human [Q13241-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q13241	Natural killer cells antigen CD94		PANTR		179	UniRef90_Q13241
Natural killer cells antigen CD94		PONPY		179
Isoform 2 of Natural killer cells antigen CD94		HUMAN		180
Killer cell lectin like receptor D1		GORGO		179
Uncharacterized protein		NOMLE		179
+31
Q13241-3	Uncharacterized protein		COLAP		148	UniRef90_Q13241-3
KLRD1 isoform 3		PONAB		148
KLRD1 isoform 3		PANTR		148
Uncharacterized protein		PANPA		148
Uncharacterized protein		RHIRO		148
+6

Protein	Similar proteins		Species	Score	Length	Source
Q13241	Natural killer cells antigen CD94		PONPY		179	UniRef50_Q13241
Natural killer cells antigen CD94		PANTR		179
Isoform 2 of Natural killer cells antigen CD94		HUMAN		180
Killer cell lectin like receptor D1		GORGO		179
Uncharacterized protein		COLAP		179
+38
Q13241-3	Natural killer cells antigen CD94		BOVIN		190	UniRef50_Q13241-3
Uncharacterized protein		RHIRO		148
Uncharacterized protein		RHIBE		148
Uncharacterized protein		COLAP		148
Uncharacterized protein		NOMLE		148
+48

Cross-referencesⁱ

Web resourcesⁱ

Functional Glycomics Gateway - Glycan Binding

CD94

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U30610 mRNA Translation: AAC50291.1 Y14287, Y14288 Genomic DNA Translation: CAA74663.1 AJ000673 Genomic DNA Translation: CAA04230.1 AJ000001 mRNA Translation: CAA03845.1 AB009597 mRNA Translation: BAA24450.1 AB010084 Genomic DNA Translation: BAA24451.1 AC022075 Genomic DNA No translation available. BC028009 mRNA Translation: AAH28009.1
CCDSⁱ	CCDS8621.1 [Q13241-1] CCDS8622.1 [Q13241-3]
RefSeqⁱ	NP_001107868.1, NM_001114396.1 [Q13241-1] NP_002253.1, NM_002262.3 [Q13241-1] NP_031360.1, NM_007334.2 [Q13241-3] XP_016874780.1, XM_017019291.1
UniGeneⁱ	Hs.562457

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1B6E	X-ray	2.60	A	52-179	[»]
	3BDW	X-ray	2.50	A/C	57-179	[»]
	3CDG	X-ray	3.40	E/J	57-179	[»]
	3CII	X-ray	4.41	G/I	59-179	[»]
ProteinModelPortalⁱ	Q13241
SMRⁱ	Q13241
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	110023, 25 interactors
IntActⁱ	Q13241, 2 interactors
STRINGⁱ	9606.ENSP00000338130

PTM databases

iPTMnetⁱ	Q13241
PhosphoSitePlusⁱ	Q13241

Polymorphism and mutation databases

BioMutaⁱ	KLRD1
DMDMⁱ	334302835

Proteomic databases

PaxDbⁱ	Q13241
PeptideAtlasⁱ	Q13241
PRIDEⁱ	Q13241
ProteomicsDBⁱ	59243 59244 [Q13241-2] 59245 [Q13241-3]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	3824
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000336164; ENSP00000338130; ENSG00000134539 [Q13241-1] ENST00000350274; ENSP00000310929; ENSG00000134539 [Q13241-3] ENST00000381908; ENSP00000371333; ENSG00000134539 [Q13241-1]
GeneIDⁱ	3824
KEGGⁱ	hsa:3824
UCSCⁱ	uc001qxw.5 human [Q13241-1]

Organism-specific databases

CTDⁱ	3824
DisGeNETⁱ	3824
EuPathDBⁱ	HostDB:ENSG00000134539.16
GeneCardsⁱ	KLRD1
HGNCⁱ	HGNC:6378 KLRD1
HPAⁱ	HPA069688
MIMⁱ	602894 gene
neXtProtⁱ	NX_Q13241
OpenTargetsⁱ	ENSG00000134539
PharmGKBⁱ	PA30167
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG4297 Eukaryota ENOG410XPJ1 LUCA
GeneTreeⁱ	ENSGT00730000110282
HOGENOMⁱ	HOG000220925
HOVERGENⁱ	HBG099800
InParanoidⁱ	Q13241
KOⁱ	K06516
OMAⁱ	YSEEHHA
OrthoDBⁱ	EOG091G0RZF
TreeFamⁱ	TF336674

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell R-HSA-2172127 DAP12 interactions R-HSA-2424491 DAP12 signaling

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-2172127 DAP12 interactions
R-HSA-2424491 DAP12 signaling

Miscellaneous databases

ChiTaRSⁱ	KLRD1 human
EvolutionaryTraceⁱ	Q13241
GeneWikiⁱ	KLRD1
GenomeRNAiⁱ	3824
Protein Ontology More...PROⁱ	PR:Q13241
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000134539 Expressed in 114 organ(s), highest expression level in leukocyte
CleanExⁱ	HS_KLRD1
ExpressionAtlasⁱ	Q13241 baseline and differential
Genevisibleⁱ	Q13241 HS

Family and domain databases

CDDⁱ	cd03593 CLECT_NK_receptors_like, 1 hit
Gene3Dⁱ	3.10.100.10, 1 hit
InterProⁱ	View protein in InterPro IPR001304 C-type_lectin-like IPR016186 C-type_lectin-like/link_sf IPR016187 CTDL_fold IPR033992 NKR-like_CTLD
Pfamⁱ	View protein in Pfam PF00059 Lectin_C, 1 hit
SMARTⁱ	View protein in SMART SM00034 CLECT, 1 hit
SUPFAMⁱ	SSF56436 SSF56436, 1 hit
PROSITEⁱ	View protein in PROSITE PS50041 C_TYPE_LECTIN_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	KLRD1_HUMAN
Accessionⁱ	Q13241Primary (citable) accession number: Q13241 Secondary accession number(s): O43321 , O43773, Q9UBE3, Q9UEQ0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	May 31, 2011
	Last modified:	November 7, 2018
	This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 12
Human chromosome 12: entries, gene names and cross-references to MIM
Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q13241 (KLRD1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Natural killer cells antigen CD94

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ