Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Natural killer cells antigen CD94

Gene

KLRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • MHC class Ib protein binding, via antigen binding groove Source: UniProtKB
  • MHC class I protein complex binding Source: UniProtKB
  • protein antigen binding Source: UniProtKB
  • transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

  • cell surface receptor signaling pathway Source: ProtInc
  • innate immune response Source: Reactome
  • natural killer cell mediated immunity Source: UniProtKB
  • regulation of immune response Source: Reactome

Keywordsi

Molecular functionReceptor
LigandLectin

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-2172127 DAP12 interactions
R-HSA-2424491 DAP12 signaling

Names & Taxonomyi

Protein namesi
Recommended name:
Natural killer cells antigen CD94
Alternative name(s):
KP43
Killer cell lectin-like receptor subfamily D member 1
NK cell receptor
CD_antigen: CD94
Gene namesi
Name:KLRD1
Synonyms:CD94
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000134539.16
HGNCiHGNC:6378 KLRD1
MIMi602894 gene
neXtProtiNX_Q13241

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 10CytoplasmicSequence analysis10
Transmembranei11 – 31Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini32 – 179ExtracellularSequence analysisAdd BLAST148

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3824
OpenTargetsiENSG00000134539
PharmGKBiPA30167

Polymorphism and mutation databases

BioMutaiKLRD1
DMDMi334302835

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000465871 – 179Natural killer cells antigen CD94Add BLAST179

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi58 ↔ 702 Publications
Disulfide bondi59Interchain (with C-116 in NGK2A)2 Publications
Disulfide bondi61 ↔ 724 Publications
Glycosylationi83N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi89 ↔ 1744 Publications
Glycosylationi132N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi152 ↔ 1664 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ13241
PeptideAtlasiQ13241
PRIDEiQ13241
ProteomicsDBi59243
59244 [Q13241-2]
59245 [Q13241-3]

PTM databases

iPTMnetiQ13241
PhosphoSitePlusiQ13241

Expressioni

Tissue specificityi

Natural killer cells.

Gene expression databases

BgeeiENSG00000134539
CleanExiHS_KLRD1
ExpressionAtlasiQ13241 baseline and differential
GenevisibleiQ13241 HS

Organism-specific databases

HPAiHPA069688

Interactioni

Subunit structurei

Can form disulfide-bonded heterodimer with NKG2 family members.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KLRC1P267155EBI-9018174,EBI-9018187

GO - Molecular functioni

  • MHC class Ib protein binding, via antigen binding groove Source: UniProtKB
  • protein antigen binding Source: UniProtKB

Protein-protein interaction databases

BioGridi110023, 25 interactors
IntActiQ13241, 5 interactors
STRINGi9606.ENSP00000338130

Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni62 – 64Combined sources3
Beta strandi66 – 68Combined sources3
Beta strandi71 – 75Combined sources5
Helixi82 – 91Combined sources10
Helixi102 – 108Combined sources7
Beta strandi118 – 122Combined sources5
Turni123 – 126Combined sources4
Beta strandi127 – 130Combined sources4
Turni138 – 140Combined sources3
Helixi142 – 146Combined sources5
Beta strandi151 – 156Combined sources6
Turni157 – 159Combined sources3
Beta strandi160 – 164Combined sources5
Beta strandi170 – 176Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B6EX-ray2.60A52-179[»]
3BDWX-ray2.50A/C57-179[»]
3CDGX-ray3.40E/J57-179[»]
3CIIX-ray4.41G/I59-179[»]
ProteinModelPortaliQ13241
SMRiQ13241
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13241

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini68 – 175C-type lectinPROSITE-ProRule annotationAdd BLAST108

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00730000110282
HOGENOMiHOG000220925
HOVERGENiHBG099800
InParanoidiQ13241
KOiK06516
OMAiDFMSSSQ
OrthoDBiEOG091G0RZF
TreeFamiTF336674

Family and domain databases

CDDicd03593 CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13241-1) [UniParc]FASTAAdd to basket
Also known as: CD94-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI
60 70 80 90 100
ELQKDSDCCS CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ
110 120 130 140 150
NTDELDFMSS SQQFYWIGLS YSEEHTAWLW ENGSALSQYL FPSFETFNTK
160 170
NCIAYNPNGN ALDESCEDKN RYICKQQLI
Length:179
Mass (Da):20,513
Last modified:May 31, 2011 - v2
Checksum:i01634D3832D4B1A7
GO
Isoform 2 (identifier: Q13241-2) [UniParc]FASTAAdd to basket
Also known as: CD94-B

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: L → LQ

Show »
Length:180
Mass (Da):20,641
Checksum:i2913D0532DAFA866
GO
Isoform 3 (identifier: Q13241-3) [UniParc]FASTAAdd to basket
Also known as: CD94 alt

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA

Show »
Length:148
Mass (Da):17,109
Checksum:i2C3876E8A2337B44
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05010325S → A3 PublicationsCorresponds to variant dbSNP:rs10772256Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0030521 – 34MAVFK…LLKNS → MAA in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_003053105L → LQ in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30610 mRNA Translation: AAC50291.1
Y14287, Y14288 Genomic DNA Translation: CAA74663.1
AJ000673 Genomic DNA Translation: CAA04230.1
AJ000001 mRNA Translation: CAA03845.1
AB009597 mRNA Translation: BAA24450.1
AB010084 Genomic DNA Translation: BAA24451.1
AC022075 Genomic DNA No translation available.
BC028009 mRNA Translation: AAH28009.1
CCDSiCCDS8621.1 [Q13241-1]
CCDS8622.1 [Q13241-3]
RefSeqiNP_001107868.1, NM_001114396.1 [Q13241-1]
NP_002253.1, NM_002262.3 [Q13241-1]
NP_031360.1, NM_007334.2 [Q13241-3]
XP_016874780.1, XM_017019291.1
UniGeneiHs.562457

Genome annotation databases

EnsembliENST00000336164; ENSP00000338130; ENSG00000134539 [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539 [Q13241-3]
ENST00000381908; ENSP00000371333; ENSG00000134539 [Q13241-1]
GeneIDi3824
KEGGihsa:3824
UCSCiuc001qxw.5 human [Q13241-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKLRD1_HUMAN
AccessioniPrimary (citable) accession number: Q13241
Secondary accession number(s): O43321
, O43773, Q9UBE3, Q9UEQ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 31, 2011
Last modified: June 20, 2018
This is version 163 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health