Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13241 (KLRD1_HUMAN)

Entry version 182 (10 Feb 2021)
Sequence version 2 (31 May 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Natural killer cells antigen CD94

Gene

KLRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Immune receptor involved in self-nonself discrimination. In complex with KLRC1 or KLRC2 on cytotoxic and regulatory lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia and non-classical MHC class Ib molecules (PubMed:9486650, PubMed:10023772, PubMed:18083576, PubMed:18064301, PubMed:9754572). Enables cytotoxic cells to monitor the expression of MHC class I molecules in healthy cells and to tolerate self (PubMed:9430220, PubMed:12387742, PubMed:18064301). Primarily functions as a ligand binding subunit as it lacks the capacity to signal.7 Publications
KLRD1-KLRC1 acts as an immune inhibitory receptor. Key inhibitory receptor on natural killer (NK) cells that regulates their activation and effector functions (PubMed:9486650, PubMed:9430220, PubMed:9485206, PubMed:30860984). Dominantly counteracts T cell receptor signaling on a subset of memory/effector CD8-positive T cells as part of an antigen-driven response to avoid autoimmunity (PubMed:12387742). On intraepithelial CD8-positive gamma-delta regulatory T cells triggers TGFB1 secretion, which in turn limits the cytotoxic programming of intraepithelial CD8-positive alpha-beta T cells, distinguishing harmless from pathogenic antigens (PubMed:18064301). In HLA-E-rich tumor microenvironment, acts as an immune inhibitory checkpoint and may contribute to progressive loss of effector functions of NK cells and tumor-specific T cells, a state known as cell exhaustion (PubMed:30503213, PubMed:30860984). Upon HLA-E-peptide binding, transmits intracellular signals through KLRC1 immunoreceptor tyrosine-based inhibition motifs (ITIMs) by recruiting INPP5D/SHIP-1 and INPPL1/SHIP-2 tyrosine phosphatases to ITIMs, and ultimately opposing signals transmitted by activating receptors through dephosphorylation of proximal signaling molecules (PubMed:9485206, PubMed:12165520).8 Publications
KLRD1-KLRC2 acts as an immune activating receptor (PubMed:9655483, PubMed:15940674). On cytotoxic lymphocyte subsets recognizes HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive NK cells and in maternal-fetal tolerance during pregnancy (PubMed:9754572, PubMed:30134159). Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection (PubMed:21825173, PubMed:20952657). Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation (PubMed:9655483, PubMed:15940674).6 Publications
(Microbial infection) Viruses like human cytomegalovirus have evolved an escape mechanism whereby virus-induced down-regulation of host MHC class I molecules is coupled to the binding of viral peptides to HLA-E, restoring HLA-E expression and inducing HLA-E-dependent NK cell immune tolerance to infected cells. Recognizes HLA-E in complex with human cytomegalovirus UL40-derived peptide (VMAPRTLIL) and inhibits NK cell cytotoxicity.2 Publications
(Microbial infection) May recognize HLA-E in complex with HIV-1 gag/Capsid protein p24-derived peptide (AISPRTLNA) on infected cells and may inhibit NK cell cytotoxicity, a mechanism that allows HIV-1 to escape immune recognition.1 Publication
(Microbial infection) Upon SARS-CoV-2 infection, may contribute to functional exhaustion of cytotoxic NK cells and CD8-positive T cells (PubMed:32859121). On NK cells, may recognize HLA-E in complex with SARS-CoV-2 S/Spike protein S1-derived peptide (LQPRTFLL) expressed on the surface of lung epithelial cells, inducing NK cell exhaustion and dampening antiviral immune surveillance (PubMed:32859121).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity, Innate immunity
LigandLectin

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q13241

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-2172127, DAP12 interactions
R-HSA-2424491, DAP12 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Natural killer cells antigen CD94
Alternative name(s):
KP43
Killer cell lectin-like receptor subfamily D member 1
NK cell receptor
CD_antigen: CD941 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLRD1
Synonyms:CD94
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6378, KLRD1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602894, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13241

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000134539.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 10CytoplasmicSequence analysis10
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei11 – 31Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini32 – 179ExtracellularSequence analysisAdd BLAST148

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi79Q → A: Has no impact on the affinity for HLA-E. 1 Publication1
Mutagenesisi112Q → A: Abolishes binding to HLA-E. 1 Publication1
Mutagenesisi114F → A: Abolishes binding to HLA-E. 1 Publication1
Mutagenesisi146T → A: Has no impact on the affinity for HLA-E. 1 Publication1
Mutagenesisi148N → A: Has no impact on the affinity for HLA-E. 1 Publication1
Mutagenesisi158N → A: Has no impact on the affinity for HLA-E. 1 Publication1
Mutagenesisi160N → A: Abolishes binding to HLA-E. 1 Publication1
Mutagenesisi162L → A: Abolishes binding to HLA-E. 1 Publication1
Mutagenesisi163D → A: Impairs binding to HLA-E. 1 Publication1
Mutagenesisi164E → A: Impairs binding to HLA-E. 1 Publication1
Mutagenesisi168D → A: Reduces binding to HLA-E. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		3824

Open Targets

More...OpenTargetsi		ENSG00000134539

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30167

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13241, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KLRD1

Domain mapping of disease mutations (DMDM)

More...DMDMi		334302835

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000465871 – 179Natural killer cells antigen CD94Add BLAST179

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi58 ↔ 702 Publications
Disulfide bondi59Interchain (with C-116 in KLRC1/NGK2A)2 Publications
Disulfide bondi61 ↔ 724 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi83N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi89 ↔ 1744 Publications
Glycosylationi132N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi152 ↔ 1664 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q13241

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q13241

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13241

PeptideAtlas

More...PeptideAtlasi		Q13241

PRoteomics IDEntifications database

More...PRIDEi		Q13241

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		59243 [Q13241-1]
59244 [Q13241-2]
59245 [Q13241-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q13241, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13241

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13241

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in NK cell subsets (at protein level) (PubMed:21825173, PubMed:9430220, PubMed:9485206). Expressed in memory/effector CD8-positive alpha-beta T cell subsets (at protein level) (PubMed:12387742, PubMed:20952657). Expressed in melanoma-specific cytotoxic T cell clones (at protein level) (PubMed:9485206). Expressed in terminally differentiated cytotoxic gamma-delta T cells (at protein level) (PubMed:20952657). KLRD1-KLRC1 and KLRD1-KLRC2 are differentially expressed in NK and T cell populations, with only minor subsets expressing both receptor complexes (at protein level) (PubMed:20952657).5 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000134539, Expressed in granulocyte and 141 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13241, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13241, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000134539, Group enriched (blood, lymphoid tissue, pituitary gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form disulfide-bonded heterodimer with NKG2 family members KLRC1 and KLRC2 (PubMed:18083576, PubMed:18332182, PubMed:18448674, PubMed:9655483). KLRD1-KLRC1 heterodimer interacts with peptide-bound HLA-E-B2M heterotrimeric complex. KLRD1 plays a prominent role in directly interacting with HLA-E (PubMed:18083576). KLRD1-KLRC1 interacts with much higher affinity with peptide-bound HLA-E-B2M than KLRD1-KLRC2 (PubMed:9486650, PubMed:10428963).

Interacts with the adapter protein TYROBP/DAP12; this interaction is required for cell surface expression and cell activation (PubMed:9655483, PubMed:15940674).

6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110023, 25 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-2502, CD94-NKG2A natural killer receptor complex
CPX-5901, CD94-NKG2C natural killer receptor complex
CPX-5903, CD94-NKG2E natural killer receptor complex

Protein interaction database and analysis system

More...IntActi		Q13241, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000371333

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q13241, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13241

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q13241

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini68 – 175C-type lectinPROSITE-ProRule annotationAdd BLAST108

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4297, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160107

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13241

Identification of Orthologs from Complete Genome Data

More...OMAi		YSEEHHA

TreeFam database of animal gene trees

More...TreeFami		TF336674

Family and domain databases

Conserved Domains Database

More...CDDi		cd03593, CLECT_NK_receptors_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.10.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001304, C-type_lectin-like
IPR016186, C-type_lectin-like/link_sf
IPR016187, CTDL_fold
IPR033992, NKR-like_CTLD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00059, Lectin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00034, CLECT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56436, SSF56436, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50041, C_TYPE_LECTIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13241-1) [UniParc]FASTAAdd to basket
Also known as: CD94-A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI 
        60         70         80         90        100
ELQKDSDCCS CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ 
       110        120        130        140        150
NTDELDFMSS SQQFYWIGLS YSEEHTAWLW ENGSALSQYL FPSFETFNTK 
       160        170 
NCIAYNPNGN ALDESCEDKN RYICKQQLI
Length:179
Mass (Da):20,513
Last modified:May 31, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i01634D3832D4B1A7
GO
Isoform 2 (identifier: Q13241-2) [UniParc]FASTAAdd to basket
Also known as: CD94-B

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: L → LQ

Show »
Length:180
Mass (Da):20,641
Checksum:i2913D0532DAFA866
GO
Isoform 3 (identifier: Q13241-3) [UniParc]FASTAAdd to basket
Also known as: CD94 alt

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA

Show »
Length:148
Mass (Da):17,109
Checksum:i2C3876E8A2337B44
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6WZH4F6WZH4_HUMAN
Natural killer cells antigen CD94
KLRD1
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GX94F5GX94_HUMAN
Natural killer cells antigen CD94
KLRD1
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PCX9E9PCX9_HUMAN
Natural killer cells antigen CD94
KLRD1
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H2B7F5H2B7_HUMAN
Natural killer cells antigen CD94
KLRD1
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFB8H0YFB8_HUMAN
Natural killer cells antigen CD94
KLRD1
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05010325S → A3 PublicationsCorresponds to variant dbSNP:rs10772256Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0030521 – 34MAVFK…LLKNS → MAA in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_003053105L → LQ in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U30610 mRNA Translation: AAC50291.1
Y14287, Y14288 Genomic DNA Translation: CAA74663.1
AJ000673 Genomic DNA Translation: CAA04230.1
AJ000001 mRNA Translation: CAA03845.1
AB009597 mRNA Translation: BAA24450.1
AB010084 Genomic DNA Translation: BAA24451.1
AC022075 Genomic DNA No translation available.
BC028009 mRNA Translation: AAH28009.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS8621.1 [Q13241-1]
CCDS8622.1 [Q13241-3]

NCBI Reference Sequences

More...RefSeqi		NP_001107868.1, NM_001114396.1 [Q13241-1]
NP_002253.1, NM_002262.3 [Q13241-1]
NP_031360.1, NM_007334.2 [Q13241-3]
XP_016874780.1, XM_017019291.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000336164; ENSP00000338130; ENSG00000134539 [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539 [Q13241-3]
ENST00000381908; ENSP00000371333; ENSG00000134539 [Q13241-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3824

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3824

UCSC genome browser

More...UCSCi		uc001qxw.5, human [Q13241-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

CD94

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30610 mRNA Translation: AAC50291.1
Y14287, Y14288 Genomic DNA Translation: CAA74663.1
AJ000673 Genomic DNA Translation: CAA04230.1
AJ000001 mRNA Translation: CAA03845.1
AB009597 mRNA Translation: BAA24450.1
AB010084 Genomic DNA Translation: BAA24451.1
AC022075 Genomic DNA No translation available.
BC028009 mRNA Translation: AAH28009.1
CCDSiCCDS8621.1 [Q13241-1]
CCDS8622.1 [Q13241-3]
RefSeqiNP_001107868.1, NM_001114396.1 [Q13241-1]
NP_002253.1, NM_002262.3 [Q13241-1]
NP_031360.1, NM_007334.2 [Q13241-3]
XP_016874780.1, XM_017019291.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B6EX-ray2.60A52-179[»]
3BDWX-ray2.50A/C57-179[»]
3CDGX-ray3.40E/J57-179[»]
3CIIX-ray4.41G/I59-179[»]
SMRiQ13241
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110023, 25 interactors
ComplexPortaliCPX-2502, CD94-NKG2A natural killer receptor complex
CPX-5901, CD94-NKG2C natural killer receptor complex
CPX-5903, CD94-NKG2E natural killer receptor complex
IntActiQ13241, 3 interactors
STRINGi9606.ENSP00000371333

PTM databases

GlyGeniQ13241, 2 sites
iPTMnetiQ13241
PhosphoSitePlusiQ13241

Genetic variation databases

BioMutaiKLRD1
DMDMi334302835

Proteomic databases

jPOSTiQ13241
MassIVEiQ13241
PaxDbiQ13241
PeptideAtlasiQ13241
PRIDEiQ13241
ProteomicsDBi59243 [Q13241-1]
59244 [Q13241-2]
59245 [Q13241-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		11712, 862 antibodies

The DNASU plasmid repository

More...DNASUi		3824

Genome annotation databases

EnsembliENST00000336164; ENSP00000338130; ENSG00000134539 [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539 [Q13241-3]
ENST00000381908; ENSP00000371333; ENSG00000134539 [Q13241-1]
GeneIDi3824
KEGGihsa:3824
UCSCiuc001qxw.5, human [Q13241-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3824
DisGeNETi3824

GeneCards: human genes, protein and diseases

More...GeneCardsi		KLRD1
HGNCiHGNC:6378, KLRD1
HPAiENSG00000134539, Group enriched (blood, lymphoid tissue, pituitary gland)
MIMi602894, gene
neXtProtiNX_Q13241
OpenTargetsiENSG00000134539
PharmGKBiPA30167
VEuPathDBiHostDB:ENSG00000134539.16

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4297, Eukaryota
GeneTreeiENSGT00940000160107
InParanoidiQ13241
OMAiYSEEHHA
TreeFamiTF336674

Enzyme and pathway databases

PathwayCommonsiQ13241
ReactomeiR-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-2172127, DAP12 interactions
R-HSA-2424491, DAP12 signaling

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3824, 5 hits in 867 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KLRD1, human
EvolutionaryTraceiQ13241

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KLRD1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3824
PharosiQ13241, Tbio

Protein Ontology

More...PROi		PR:Q13241
RNActiQ13241, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000134539, Expressed in granulocyte and 141 other tissues
ExpressionAtlasiQ13241, baseline and differential
GenevisibleiQ13241, HS

Family and domain databases

CDDicd03593, CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304, C-type_lectin-like
IPR016186, C-type_lectin-like/link_sf
IPR016187, CTDL_fold
IPR033992, NKR-like_CTLD
PfamiView protein in Pfam
PF00059, Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034, CLECT, 1 hit
SUPFAMiSSF56436, SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041, C_TYPE_LECTIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLRD1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13241
Secondary accession number(s): O43321
, O43773, Q9UBE3, Q9UEQ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 31, 2011
Last modified: February 10, 2021
This is version 182 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human variants curated from literature reports
    Index of human variants curated from literature reports
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with genetic variants
    List of human entries with genetic variants
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again