Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - Q13239 (SLAP1_HUMAN)

Entry version 187 (25 May 2022)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Src-like-adapter

Gene

SLA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q13239

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-9706369, Negative regulation of FLT3

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q13239

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q13239

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Src-like-adapter
Alternative name(s):
Src-like-adapter protein 1
Short name:
SLAP-1
Short name:
hSLAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLA
Synonyms:SLAP, SLAP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10902, SLA

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601099, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13239

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000155926

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Endosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi111R → K: Strongly reduces interaction with ZAP70, CD3Z, SYK and LAT. 1 Publication1
Mutagenesisi218L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-224 and S-229. 1 Publication1
Mutagenesisi224L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-218 and S-229. 1 Publication1
Mutagenesisi229L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-218 and S-224. 1 Publication1
Mutagenesisi237 – 239LSL → QSQ: Abolishes interaction with CBL. Slightly affects dimerization. 1 Publication3

Organism-specific databases

DisGeNET

More...DisGeNETi		6503

MalaCards human disease database

More...MalaCardsi		SLA

Open Targets

More...OpenTargetsi		ENSG00000155926

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35802

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13239, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLA

Domain mapping of disease mutations (DMDM)

More...DMDMi		30173237

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000719462 – 276Src-like-adapterAdd BLAST275

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei253PhosphoserineBy similarity1
Modified residuei273PhosphotyrosineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q13239

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q13239

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13239

PeptideAtlas

More...PeptideAtlasi		Q13239

PRoteomics IDEntifications database

More...PRIDEi		Q13239

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		59242 [Q13239-1]
6601
6612

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13239

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13239

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By all-trans retinoic acid (ATRA). Induction is indirect and is mediated through other proteins.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000155926, Expressed in cortical plate and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13239, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13239, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000155926, Group enriched (bone marrow, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EPHA2, VAV1, LCP2 and PDGFRB (By similarity). Homodimer. Homodimerization and interaction with phosphorylated CBL occurs via its C-terminal domain.

Interacts with phosphorylated proteins ZAP70, CD3Z, SYK and LAT via its SH2 domain.

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112394, 26 interactors

Protein interaction database and analysis system

More...IntActi		Q13239, 38 interactors

Molecular INTeraction database

More...MINTi		Q13239

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000394049

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q13239, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1276
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q13239

Biological Magnetic Resonance Data Bank

More...BMRBi		Q13239

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13239

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q13239

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 82SH3PROSITE-ProRule annotationAdd BLAST61
Domaini84 – 175SH2PROSITE-ProRule annotationAdd BLAST92

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni212 – 276SLA C-terminalAdd BLAST65

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal domain is essential for the homodimerization and the interaction with CBL. While the interaction with CBL is apparently mediated via the hydrophobic region of this domain, the highly charged region is apparently required for the homodimerization.

Keywords - Domaini

SH2 domain, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QPWY, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159104

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_084503_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13239

Database of Orthologous Groups

More...OrthoDBi		1051480at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q13239

Family and domain databases

Conserved Domains Database

More...CDDi		cd10344, SH2_SLAP, 1 hit
cd12010, SH3_SLAP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR035055, SLAP
IPR035052, SLAP_SH2
IPR035596, SLAP_SH3

The PANTHER Classification System

More...PANTHERi		PTHR24418:SF293, PTHR24418:SF293, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00017, SH2, 1 hit
PF00018, SH3_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00401, SH2DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00252, SH2, 1 hit
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50001, SH2, 1 hit
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13239-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNSMKSTPA PAERPLPNPE GLDSDFLAVL SDYPSPDISP PIFRRGEKLR 
        60         70         80         90        100
VISDEGGWWK AISLSTGRES YIPGICVARV YHGWLFEGLG RDKAEELLQL 
       110        120        130        140        150
PDTKVGSFMI RESETKKGFY SLSVRHRQVK HYRIFRLPNN WYYISPRLTF 
       160        170        180        190        200
QCLEDLVNHY SEVADGLCCV LTTPCLTQST AAPAVRASSS PVTLRQKTVD 
       210        220        230        240        250
WRRVSRLQED PEGTENPLGV DESLFSYGLR ESIASYLSLT SEDNTSFDRK 
       260        270 
KKSISLMYGG SKRKSSFFSS PPYFED
Length:276
Mass (Da):31,156
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB0FCC7D7B2ECA378
GO
Isoform 2 (identifier: Q13239-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Show »
Length:168
Mass (Da):19,285
Checksum:i0BC12A843F32869D
GO
Isoform 3 (identifier: Q13239-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHRLWASPAAPGKKKEM

Show »
Length:293
Mass (Da):33,059
Checksum:i6721FE5A9562C6DC
GO
Isoform 4 (identifier: Q13239-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHRLWASPAAPGKKKEM
     118-161: Missing.

Show »
Length:249
Mass (Da):27,558
Checksum:iD072FF483DAA2778
GO
Isoform 5 (identifier: Q13239-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSKLGHSPLGGLRARLTFPVCLLYHRLWASPAAPGKKKEM

Show »
Length:316
Mass (Da):35,540
Checksum:i93C3155474168A96
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RHT2E5RHT2_HUMAN
Src-like-adapter
SLA
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RH80E5RH80_HUMAN
Src-like-adapter
SLA
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGG0E5RGG0_HUMAN
Src-like-adapter
SLA
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJ69E5RJ69_HUMAN
Src-like-adapter
SLA
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RK29E5RK29_HUMAN
Src-like-adapter
SLA
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RK95E5RK95_HUMAN
Src-like-adapter
SLA
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJB0E5RJB0_HUMAN
Src-like-adapter
SLA
14Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH07042 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG35478 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti71Y → D in CAB53536 (PubMed:11179692).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06170615P → T. Corresponds to variant dbSNP:rs4486183Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0551221 – 108Missing in isoform 2. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_0551231M → MLHRLWASPAAPGKKKEM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_0551241M → MLSKLGHSPLGGLRARLTFP VCLLYHRLWASPAAPGKKKE M in isoform 5. 1 Publication1
Alternative sequenceiVSP_055125118 – 161Missing in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U30473 mRNA Translation: AAC50357.1
D89077 mRNA Translation: BAA13758.1
U44403 mRNA Translation: AAC27662.1
CR536537 mRNA Translation: CAG38774.1
AK297423 mRNA Translation: BAH12578.1
AK297519 mRNA Translation: BAH12602.1
AK312584 mRNA Translation: BAG35478.1 Different initiation.
AF235100 Genomic DNA No translation available.
AF305872 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW92159.1
BC007042 mRNA Translation: AAH07042.1 Different initiation.
AJ238591 mRNA Translation: CAB53536.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47922.1 [Q13239-3]
CCDS47923.1 [Q13239-5]
CCDS6370.1 [Q13239-1]
CCDS64977.1 [Q13239-2]
CCDS64978.1 [Q13239-4]

NCBI Reference Sequences

More...RefSeqi		NP_001039021.1, NM_001045556.2 [Q13239-1]
NP_001039022.2, NM_001045557.2 [Q13239-3]
NP_001269893.1, NM_001282964.1 [Q13239-4]
NP_001269894.1, NM_001282965.1 [Q13239-2]
NP_006739.2, NM_006748.3 [Q13239-5]
XP_016869228.1, XM_017013739.1 [Q13239-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000338087.10; ENSP00000337548.5; ENSG00000155926.14
ENST00000395352.7; ENSP00000378759.3; ENSG00000155926.14 [Q13239-3]
ENST00000427060.6; ENSP00000394049.2; ENSG00000155926.14 [Q13239-5]
ENST00000517648.5; ENSP00000428559.1; ENSG00000155926.14 [Q13239-4]
ENST00000524345.5; ENSP00000427928.1; ENSG00000155926.14 [Q13239-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6503

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6503

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000338087.10; ENSP00000337548.5; NM_001045556.3; NP_001039021.1

UCSC genome browser

More...UCSCi		uc003ytz.4, human [Q13239-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30473 mRNA Translation: AAC50357.1
D89077 mRNA Translation: BAA13758.1
U44403 mRNA Translation: AAC27662.1
CR536537 mRNA Translation: CAG38774.1
AK297423 mRNA Translation: BAH12578.1
AK297519 mRNA Translation: BAH12602.1
AK312584 mRNA Translation: BAG35478.1 Different initiation.
AF235100 Genomic DNA No translation available.
AF305872 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW92159.1
BC007042 mRNA Translation: AAH07042.1 Different initiation.
AJ238591 mRNA Translation: CAB53536.1
CCDSiCCDS47922.1 [Q13239-3]
CCDS47923.1 [Q13239-5]
CCDS6370.1 [Q13239-1]
CCDS64977.1 [Q13239-2]
CCDS64978.1 [Q13239-4]
RefSeqiNP_001039021.1, NM_001045556.2 [Q13239-1]
NP_001039022.2, NM_001045557.2 [Q13239-3]
NP_001269893.1, NM_001282964.1 [Q13239-4]
NP_001269894.1, NM_001282965.1 [Q13239-2]
NP_006739.2, NM_006748.3 [Q13239-5]
XP_016869228.1, XM_017013739.1 [Q13239-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CUDNMR-A15-80[»]
AlphaFoldDBiQ13239
BMRBiQ13239
SMRiQ13239
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112394, 26 interactors
IntActiQ13239, 38 interactors
MINTiQ13239
STRINGi9606.ENSP00000394049

PTM databases

iPTMnetiQ13239
PhosphoSitePlusiQ13239

Genetic variation databases

BioMutaiSLA
DMDMi30173237

Proteomic databases

MassIVEiQ13239
MaxQBiQ13239
PaxDbiQ13239
PeptideAtlasiQ13239
PRIDEiQ13239
ProteomicsDBi59242 [Q13239-1]
6601
6612

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1995, 132 antibodies from 27 providers

The DNASU plasmid repository

More...DNASUi		6503

Genome annotation databases

EnsembliENST00000338087.10; ENSP00000337548.5; ENSG00000155926.14
ENST00000395352.7; ENSP00000378759.3; ENSG00000155926.14 [Q13239-3]
ENST00000427060.6; ENSP00000394049.2; ENSG00000155926.14 [Q13239-5]
ENST00000517648.5; ENSP00000428559.1; ENSG00000155926.14 [Q13239-4]
ENST00000524345.5; ENSP00000427928.1; ENSG00000155926.14 [Q13239-2]
GeneIDi6503
KEGGihsa:6503
MANE-SelectiENST00000338087.10; ENSP00000337548.5; NM_001045556.3; NP_001039021.1
UCSCiuc003ytz.4, human [Q13239-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6503
DisGeNETi6503

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLA
HGNCiHGNC:10902, SLA
HPAiENSG00000155926, Group enriched (bone marrow, lymphoid tissue)
MalaCardsiSLA
MIMi601099, gene
neXtProtiNX_Q13239
OpenTargetsiENSG00000155926
PharmGKBiPA35802
VEuPathDBiHostDB:ENSG00000155926

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QPWY, Eukaryota
GeneTreeiENSGT00940000159104
HOGENOMiCLU_084503_1_0_1
InParanoidiQ13239
OrthoDBi1051480at2759
PhylomeDBiQ13239

Enzyme and pathway databases

PathwayCommonsiQ13239
ReactomeiR-HSA-9706369, Negative regulation of FLT3
SignaLinkiQ13239
SIGNORiQ13239

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6503, 17 hits in 1075 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLA, human
EvolutionaryTraceiQ13239

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6503
PharosiQ13239, Tbio

Protein Ontology

More...PROi		PR:Q13239
RNActiQ13239, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000155926, Expressed in cortical plate and 225 other tissues
ExpressionAtlasiQ13239, baseline and differential
GenevisibleiQ13239, HS

Family and domain databases

CDDicd10344, SH2_SLAP, 1 hit
cd12010, SH3_SLAP, 1 hit
Gene3Di3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR035055, SLAP
IPR035052, SLAP_SH2
IPR035596, SLAP_SH3
PANTHERiPTHR24418:SF293, PTHR24418:SF293, 1 hit
PfamiView protein in Pfam
PF00017, SH2, 1 hit
PF00018, SH3_1, 1 hit
PRINTSiPR00401, SH2DOMAIN
SMARTiView protein in SMART
SM00252, SH2, 1 hit
SM00326, SH3, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001, SH2, 1 hit
PS50002, SH3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSLAP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13239
Secondary accession number(s): B7Z4J2
, B7Z4L6, Q6FI01, Q9UMQ8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: January 23, 2007
Last modified: May 25, 2022
This is version 187 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again