Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (16 Oct 2019)
Sequence version 2 (29 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Methanethiol oxidase

Gene

SELENBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the oxidation of methanethiol, an organosulfur compound known to be produced in substantial amounts by gut bacteria (PubMed:29255262). Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport (By similarity).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=4.8 nM for methanethiol1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: Organosulfur degradation

    This protein is involved in Organosulfur degradation.1 Publication
    View all proteins of this organism that are known to be involved in Organosulfur degradation.

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionOxidoreductase
    Biological processProtein transport, Transport
    LigandSelenium

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Methanethiol oxidase1 Publication (EC:1.8.3.41 Publication)
    Short name:
    MTO1 Publication
    Alternative name(s):
    56 kDa selenium-binding protein
    Short name:
    SBP56
    Short name:
    SP56
    Selenium-binding protein 1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:SELENBP1
    Synonyms:SBP
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:10719 SELENBP1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    604188 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q13228

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Extraoral halitosis due to methanethiol oxidase deficiency (EHMTO)1 Publication
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionAn autosomal recessive malodor condition characterized by extraoral blood-borne halitosis resulting from the accumulation of sulfur-containing metabolites. In extraoral blood-borne halitosis, malodorant compounds are carried to the lungs, where they enter the breath. Affected individuals have a cabbage-like breath odor, high levels of methanethiol and dimethylsulfide in oral and nasal breath, and elevated urinary excretion of dimethylsulfoxide in the absence of intake of dimethylsulfide-containing food or use of sulfur-containing medication, lower-gastrointestinal problems, and known metabolic defects, such as methionine adenosyltransferase deficiency and tyrosinemia.
    Related information in OMIM
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_080207225G → W in EHMTO; loss of methanethiol oxidation in patient cells. 1 PublicationCorresponds to variant dbSNP:rs758495626EnsemblClinVar.1
    Natural variantiVAR_080208329H → Y in EHMTO; loss of methanethiol oxidation in patient cells. 1 PublicationCorresponds to variant dbSNP:rs1553204840EnsemblClinVar.1
    Natural variantiVAR_080209347 – 472Missing in EHMTO; loss of methanethiol oxidation in patient cells. 1 PublicationAdd BLAST126

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    8991

    MalaCards human disease database

    More...
    MalaCardsi
    SELENBP1
    MIMi618148 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000143416

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA35641

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q13228

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    SELENBP1

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    148840437

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001746332 – 472Methanethiol oxidaseAdd BLAST471

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
    Modified residuei111PhosphoserineCombined sources1
    Modified residuei371PhosphoserineCombined sources1
    Modified residuei467PhosphoserineBy similarity1

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    Phosphorylated.1 Publication
    The N-terminus is blocked.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q13228

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q13228

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q13228

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q13228

    PeptideAtlas

    More...
    PeptideAtlasi
    Q13228

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q13228

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    1722
    5753
    59234 [Q13228-1]
    59235 [Q13228-2]

    2D gel databases

    REPRODUCTION-2DPAGE

    More...
    REPRODUCTION-2DPAGEi
    IPI00012303
    Q13228

    University College Dublin 2-DE Proteome Database

    More...
    UCD-2DPAGEi
    Q13228

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q13228

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q13228

    SwissPalm database of S-palmitoylation events

    More...
    SwissPalmi
    Q13228

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Widely expressed. Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.6 Publications

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Down-regulated by androgen in prostate cancer cells.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000143416 Expressed in 221 organ(s), highest expression level in mucosa of transverse colon

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q13228 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q13228 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    CAB008366
    HPA005741
    HPA011731

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with USP33.

    1 Publication

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    114472, 82 interactors

    CORUM comprehensive resource of mammalian protein complexes

    More...
    CORUMi
    Q13228

    Protein interaction database and analysis system

    More...
    IntActi
    Q13228, 42 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q13228

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000397261

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q13228

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the selenium-binding protein family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG0918 Eukaryota
    ENOG410XP4F LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00390000014244

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000263885

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q13228

    KEGG Orthology (KO)

    More...
    KOi
    K17285

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    GQIMISC

    Database of Orthologous Groups

    More...
    OrthoDBi
    483905at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q13228

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF315241

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR008826 Se-bd

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR23300 PTHR23300, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF05694 SBP56, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q13228-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MATKCGNCGP GYSTPLEAMK GPREEIVYLP CIYRNTGTEA PDYLATVDVD
    60 70 80 90 100
    PKSPQYCQVI HRLPMPNLKD ELHHSGWNTC SSCFGDSTKS RTKLVLPSLI
    110 120 130 140 150
    SSRIYVVDVG SEPRAPKLHK VIEPKDIHAK CELAFLHTSH CLASGEVMIS
    160 170 180 190 200
    SLGDVKGNGK GGFVLLDGET FEVKGTWERP GGAAPLGYDF WYQPRHNVMI
    210 220 230 240 250
    STEWAAPNVL RDGFNPADVE AGLYGSHLYV WDWQRHEIVQ TLSLKDGLIP
    260 270 280 290 300
    LEIRFLHNPD AAQGFVGCAL SSTIQRFYKN EGGTWSVEKV IQVPPKKVKG
    310 320 330 340 350
    WLLPEMPGLI TDILLSLDDR FLYFSNWLHG DLRQYDISDP QRPRLTGQLF
    360 370 380 390 400
    LGGSIVKGGP VQVLEDEELK SQPEPLVVKG KRVAGGPQMI QLSLDGKRLY
    410 420 430 440 450
    ITTSLYSAWD KQFYPDLIRE GSVMLQVDVD TVKGGLKLNP NFLVDFGKEP
    460 470
    LGPALAHELR YPGGDCSSDI WI
    Length:472
    Mass (Da):52,391
    Last modified:May 29, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6DC68F9B45FEC1BC
    GO
    Isoform 2 (identifier: Q13228-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-64: Missing.

    Show »
    Length:408
    Mass (Da):45,349
    Checksum:i7765636B7CE8ACA7
    GO
    Isoform 3 (identifier: Q13228-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-120: Missing.

    Show »
    Length:410
    Mass (Da):45,469
    Checksum:i966714583DDE49F3
    GO
    Isoform 4 (identifier: Q13228-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRLEWGPRPAALPWPAGMCAAERAEGAFTLQSVAQPMRPIAST

    Show »
    Length:514
    Mass (Da):56,866
    Checksum:iB0D47E495DD73E67
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    A6PVX1A6PVX1_HUMAN
    Methanethiol oxidase
    SELENBP1
    295Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9JVL0C9JVL0_HUMAN
    Methanethiol oxidase
    SELENBP1
    80Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F2Z2W8F2Z2W8_HUMAN
    Methanethiol oxidase
    SELENBP1
    123Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8WCR4F8WCR4_HUMAN
    Methanethiol oxidase
    SELENBP1
    165Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0Y532H0Y532_HUMAN
    Methanethiol oxidase
    SELENBP1
    305Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8WBA9F8WBA9_HUMAN
    Methanethiol oxidase
    SELENBP1
    47Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti80C → Y in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti92T → N in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti114 – 116RAP → GPQ in AAB02395 (PubMed:9027582).Curated3
    Sequence conflicti135F → C in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti260 – 262DAA → SAT in AAB02395 (PubMed:9027582).Curated3
    Sequence conflicti270 – 273LSST → SAPN in AAB02395 (PubMed:9027582).Curated4
    Sequence conflicti278Y → C in BAG59258 (PubMed:14702039).Curated1
    Sequence conflicti280 – 282NEG → TRE in AAB02395 (PubMed:9027582).Curated3
    Sequence conflicti305 – 306EM → GV in AAB02395 (PubMed:9027582).Curated2
    Sequence conflicti410D → E in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti442F → C in AAB02395 (PubMed:9027582).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_080207225G → W in EHMTO; loss of methanethiol oxidation in patient cells. 1 PublicationCorresponds to variant dbSNP:rs758495626EnsemblClinVar.1
    Natural variantiVAR_080208329H → Y in EHMTO; loss of methanethiol oxidation in patient cells. 1 PublicationCorresponds to variant dbSNP:rs1553204840EnsemblClinVar.1
    Natural variantiVAR_080209347 – 472Missing in EHMTO; loss of methanethiol oxidation in patient cells. 1 PublicationAdd BLAST126

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0384401 – 64Missing in isoform 2. 1 PublicationAdd BLAST64
    Alternative sequenceiVSP_0551261M → MRLEWGPRPAALPWPAGMCA AERAEGAFTLQSVAQPMRPI AST in isoform 4. 1 Publication1
    Alternative sequenceiVSP_04542559 – 120Missing in isoform 3. 1 PublicationAdd BLAST62

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    U29091 mRNA Translation: AAB02395.1
    CR456852 mRNA Translation: CAG33133.1
    AK296661 mRNA Translation: BAG59258.1
    AK303815 mRNA Translation: BAG64765.1
    AK315643 mRNA Translation: BAG38010.1
    AL391069 Genomic DNA No translation available.
    CH471121 Genomic DNA Translation: EAW53443.1
    CH471121 Genomic DNA Translation: EAW53445.1
    BC009084 mRNA Translation: AAH09084.1
    BC032997 mRNA Translation: AAH32997.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS58027.1 [Q13228-3]
    CCDS60266.1 [Q13228-4]
    CCDS995.1 [Q13228-1]

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    G01872

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001245217.1, NM_001258288.1 [Q13228-3]
    NP_001245218.1, NM_001258289.1 [Q13228-4]
    NP_003935.2, NM_003944.3 [Q13228-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000368868; ENSP00000357861; ENSG00000143416 [Q13228-1]
    ENST00000426705; ENSP00000397261; ENSG00000143416 [Q13228-4]
    ENST00000447402; ENSP00000413960; ENSG00000143416 [Q13228-3]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    8991

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:8991

    UCSC genome browser

    More...
    UCSCi
    uc010pcy.4 human [Q13228-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    U29091 mRNA Translation: AAB02395.1
    CR456852 mRNA Translation: CAG33133.1
    AK296661 mRNA Translation: BAG59258.1
    AK303815 mRNA Translation: BAG64765.1
    AK315643 mRNA Translation: BAG38010.1
    AL391069 Genomic DNA No translation available.
    CH471121 Genomic DNA Translation: EAW53443.1
    CH471121 Genomic DNA Translation: EAW53445.1
    BC009084 mRNA Translation: AAH09084.1
    BC032997 mRNA Translation: AAH32997.1
    CCDSiCCDS58027.1 [Q13228-3]
    CCDS60266.1 [Q13228-4]
    CCDS995.1 [Q13228-1]
    PIRiG01872
    RefSeqiNP_001245217.1, NM_001258288.1 [Q13228-3]
    NP_001245218.1, NM_001258289.1 [Q13228-4]
    NP_003935.2, NM_003944.3 [Q13228-1]

    3D structure databases

    SMRiQ13228
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi114472, 82 interactors
    CORUMiQ13228
    IntActiQ13228, 42 interactors
    MINTiQ13228
    STRINGi9606.ENSP00000397261

    PTM databases

    iPTMnetiQ13228
    PhosphoSitePlusiQ13228
    SwissPalmiQ13228

    Polymorphism and mutation databases

    BioMutaiSELENBP1
    DMDMi148840437

    2D gel databases

    REPRODUCTION-2DPAGEiIPI00012303
    Q13228
    UCD-2DPAGEiQ13228

    Proteomic databases

    EPDiQ13228
    jPOSTiQ13228
    MassIVEiQ13228
    PaxDbiQ13228
    PeptideAtlasiQ13228
    PRIDEiQ13228
    ProteomicsDBi1722
    5753
    59234 [Q13228-1]
    59235 [Q13228-2]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    8991

    Genome annotation databases

    EnsembliENST00000368868; ENSP00000357861; ENSG00000143416 [Q13228-1]
    ENST00000426705; ENSP00000397261; ENSG00000143416 [Q13228-4]
    ENST00000447402; ENSP00000413960; ENSG00000143416 [Q13228-3]
    GeneIDi8991
    KEGGihsa:8991
    UCSCiuc010pcy.4 human [Q13228-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    8991
    DisGeNETi8991

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    SELENBP1
    HGNCiHGNC:10719 SELENBP1
    HPAiCAB008366
    HPA005741
    HPA011731
    MalaCardsiSELENBP1
    MIMi604188 gene
    618148 phenotype
    neXtProtiNX_Q13228
    OpenTargetsiENSG00000143416
    PharmGKBiPA35641

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG0918 Eukaryota
    ENOG410XP4F LUCA
    GeneTreeiENSGT00390000014244
    HOGENOMiHOG000263885
    InParanoidiQ13228
    KOiK17285
    OMAiGQIMISC
    OrthoDBi483905at2759
    PhylomeDBiQ13228
    TreeFamiTF315241

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    SELENBP1 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    SELENBP1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    8991
    PharosiQ13228

    Protein Ontology

    More...
    PROi
    PR:Q13228

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000143416 Expressed in 221 organ(s), highest expression level in mucosa of transverse colon
    ExpressionAtlasiQ13228 baseline and differential
    GenevisibleiQ13228 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR008826 Se-bd
    PANTHERiPTHR23300 PTHR23300, 1 hit
    PfamiView protein in Pfam
    PF05694 SBP56, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSBP1_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13228
    Secondary accession number(s): A6NML9
    , A6PVW9, B2RDR3, B4DKP6, B4E1F3, Q49AQ8, Q96GX7
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: May 29, 2007
    Last modified: October 16, 2019
    This is version 165 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    6. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again