Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Syntaxin-5

Gene

STX5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates endoplasmic reticulum to Golgi transport. Together with p115/USO1 and GM130/GOLGA2, involved in vesicle tethering and fusion at the cis-Golgi membrane to maintain the stacked and inter-connected structure of the Golgi apparatus.By similarity

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • protein N-terminus binding Source: UniProtKB
  • SNAP receptor activity Source: HGNC
  • SNARE binding Source: GO_Central

GO - Biological processi

Keywordsi

Biological processTransport

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-5694530 Cargo concentration in the ER
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811438 Intra-Golgi traffic

Names & Taxonomyi

Protein namesi
Recommended name:
Syntaxin-5
Gene namesi
Name:STX5
Synonyms:STX5A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000162236.11
HGNCiHGNC:11440 STX5
MIMi603189 gene
neXtProtiNX_Q13190

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 333CytoplasmicSequence analysisAdd BLAST333
Transmembranei334 – 354Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini355VesicularSequence analysis1

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi245I → A: Loss of interaction with SEC24C. 1 Publication1
Mutagenesisi247M → A: Loss of interaction with SEC24C. 1 Publication1

Organism-specific databases

DisGeNETi6811
OpenTargetsiENSG00000162236
PharmGKBiPA36237

Polymorphism and mutation databases

BioMutaiSTX5
DMDMi114152881

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002102051 – 355Syntaxin-5Add BLAST355

Proteomic databases

EPDiQ13190
MaxQBiQ13190
PaxDbiQ13190
PeptideAtlasiQ13190
PRIDEiQ13190
ProteomicsDBi59212
59213 [Q13190-2]
59214 [Q13190-3]

PTM databases

iPTMnetiQ13190
PhosphoSitePlusiQ13190

Expressioni

Gene expression databases

BgeeiENSG00000162236 Expressed in 93 organ(s), highest expression level in blood
CleanExiHS_STX5
ExpressionAtlasiQ13190 baseline and differential
GenevisibleiQ13190 HS

Organism-specific databases

HPAiHPA001358

Interactioni

Subunit structurei

Part of a ternary complex containing STX5A, NSFL1C and VCP (By similarity). Identified in a unique SNARE complex composed of the Golgi SNAREs GOSR1, GOSR2, YKT6 and VTI1A (By similarity). Interacts with COG4 (PubMed:19536132). Interacts with GM130/GOLGA2 (By similarity). Interacts (via IxM motif) with SEC24C and SEC24D; mediates STX5 packaging into COPII-coated vesicles (PubMed:18843296).By similarity2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112680, 82 interactors
DIPiDIP-56987N
IntActiQ13190, 55 interactors
MINTiQ13190
STRINGi9606.ENSP00000294179

Structurei

Secondary structure

1355
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ13190
SMRiQ13190
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13190

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini263 – 325t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili287 – 318Sequence analysisAdd BLAST32

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi245 – 247IxM motif; signal for cargo packaging into COPII-coated vesicles1 Publication3

Sequence similaritiesi

Belongs to the syntaxin family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0812 Eukaryota
ENOG410Y2MB LUCA
GeneTreeiENSGT00390000000652
HOGENOMiHOG000194860
HOVERGENiHBG001973
InParanoidiQ13190
KOiK08490
OMAiQDRTNEF
OrthoDBiEOG091G0HR8
PhylomeDBiQ13190
TreeFamiTF315068

Family and domain databases

InterProiView protein in InterPro
IPR010989 SNARE
IPR021538 Syntaxin-5_N
IPR006012 Syntaxin/epimorphin_CS
IPR000727 T_SNARE_dom
PfamiView protein in Pfam
PF05739 SNARE, 1 hit
PF11416 Syntaxin-5_N, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 1 hit
SUPFAMiSSF47661 SSF47661, 1 hit
PROSITEiView protein in PROSITE
PS00914 SYNTAXIN, 1 hit
PS50192 T_SNARE, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13190-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIPRKRYGSK NTDQGVYLGL SKTQVLSPAT AGSSSSDIAP LPPPVTLVPP
60 70 80 90 100
PPDTMSCRDR TQEFLSACKS LQTRQNGIQT NKPALRAVRQ RSEFTLMAKR
110 120 130 140 150
IGKDLSNTFA KLEKLTILAK RKSLFDDKAV EIEELTYIIK QDINSLNKQI
160 170 180 190 200
AQLQDFVRAK GSQSGRHLQT HSNTIVVSLQ SKLASMSNDF KSVLEVRTEN
210 220 230 240 250
LKQQRSRREQ FSRAPVSALP LAPNHLGGGA VVLGAESHAS KDVAIDMMDS
260 270 280 290 300
RTSQQLQLID EQDSYIQSRA DTMQNIESTI VELGSIFQQL AHMVKEQEET
310 320 330 340 350
IQRIDENVLG AQLDVEAAHS EILKYFQSVT SNRWLMVKIF LILIVFFIIF

VVFLA
Length:355
Mass (Da):39,673
Last modified:September 5, 2006 - v2
Checksum:iEE8616A226888501
GO
Isoform 2 (identifier: Q13190-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.

Note: Produced by alternative initiation at Met-55 of isoform 1.
Show »
Length:301
Mass (Da):34,086
Checksum:iC531C6BCCFA466B2
GO
Isoform 3 (identifier: Q13190-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.
     303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC

Note: Produced by alternative splicing and alternative initiation.
Show »
Length:267
Mass (Da):29,887
Checksum:iF9C4A7DAACB83BD7
GO
Isoform 4 (identifier: Q13190-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC

Note: Gene prediction based on EST data.
Show »
Length:321
Mass (Da):35,474
Checksum:i846547400C331556
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PNU4E9PNU4_HUMAN
Syntaxin-5
STX5
250Annotation score:
H7C3X5H7C3X5_HUMAN
Syntaxin-5
STX5
158Annotation score:
E9PRW9E9PRW9_HUMAN
Syntaxin-5
STX5
81Annotation score:
E9PP18E9PP18_HUMAN
Syntaxin-5
STX5
78Annotation score:
H0YEJ8H0YEJ8_HUMAN
Syntaxin-5
STX5
67Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05224851P → L. Corresponds to variant dbSNP:rs3802945Ensembl.1
Natural variantiVAR_05224972Q → H. Corresponds to variant dbSNP:rs11231241Ensembl.1
Natural variantiVAR_03564279Q → H in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0201191 – 54Missing in isoform 2 and isoform 3. 4 PublicationsAdd BLAST54
Alternative sequenceiVSP_020120303 – 355RIDEN…VVFLA → SVLLFPLLPALSPGSTRTC in isoform 3 and isoform 4. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26648 mRNA Translation: AAC71078.1
BX537426 mRNA Translation: CAD97668.1
AK313497 mRNA Translation: BAG36279.1
BT019646 mRNA Translation: AAV38452.1
BT019647 mRNA Translation: AAV38453.1
AP001160 Genomic DNA No translation available.
BC002645 mRNA Translation: AAH02645.1
BC012137 mRNA Translation: AAH12137.2
CCDSiCCDS58140.1 [Q13190-4]
CCDS8038.2 [Q13190-1]
CCDS81578.1 [Q13190-2]
PIRiG01817
RefSeqiNP_001231595.1, NM_001244666.1 [Q13190-4]
NP_001317223.1, NM_001330294.1 [Q13190-2]
NP_003155.2, NM_003164.4 [Q13190-1]
UniGeneiHs.654602

Genome annotation databases

EnsembliENST00000294179; ENSP00000294179; ENSG00000162236 [Q13190-1]
ENST00000377897; ENSP00000367129; ENSG00000162236 [Q13190-4]
ENST00000394690; ENSP00000378182; ENSG00000162236 [Q13190-2]
GeneIDi6811
KEGGihsa:6811
UCSCiuc001nvh.4 human [Q13190-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26648 mRNA Translation: AAC71078.1
BX537426 mRNA Translation: CAD97668.1
AK313497 mRNA Translation: BAG36279.1
BT019646 mRNA Translation: AAV38452.1
BT019647 mRNA Translation: AAV38453.1
AP001160 Genomic DNA No translation available.
BC002645 mRNA Translation: AAH02645.1
BC012137 mRNA Translation: AAH12137.2
CCDSiCCDS58140.1 [Q13190-4]
CCDS8038.2 [Q13190-1]
CCDS81578.1 [Q13190-2]
PIRiG01817
RefSeqiNP_001231595.1, NM_001244666.1 [Q13190-4]
NP_001317223.1, NM_001330294.1 [Q13190-2]
NP_003155.2, NM_003164.4 [Q13190-1]
UniGeneiHs.654602

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EFOX-ray2.70C242-248[»]
ProteinModelPortaliQ13190
SMRiQ13190
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112680, 82 interactors
DIPiDIP-56987N
IntActiQ13190, 55 interactors
MINTiQ13190
STRINGi9606.ENSP00000294179

PTM databases

iPTMnetiQ13190
PhosphoSitePlusiQ13190

Polymorphism and mutation databases

BioMutaiSTX5
DMDMi114152881

Proteomic databases

EPDiQ13190
MaxQBiQ13190
PaxDbiQ13190
PeptideAtlasiQ13190
PRIDEiQ13190
ProteomicsDBi59212
59213 [Q13190-2]
59214 [Q13190-3]

Protocols and materials databases

DNASUi6811
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294179; ENSP00000294179; ENSG00000162236 [Q13190-1]
ENST00000377897; ENSP00000367129; ENSG00000162236 [Q13190-4]
ENST00000394690; ENSP00000378182; ENSG00000162236 [Q13190-2]
GeneIDi6811
KEGGihsa:6811
UCSCiuc001nvh.4 human [Q13190-1]

Organism-specific databases

CTDi6811
DisGeNETi6811
EuPathDBiHostDB:ENSG00000162236.11
GeneCardsiSTX5
HGNCiHGNC:11440 STX5
HPAiHPA001358
MIMi603189 gene
neXtProtiNX_Q13190
OpenTargetsiENSG00000162236
PharmGKBiPA36237
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0812 Eukaryota
ENOG410Y2MB LUCA
GeneTreeiENSGT00390000000652
HOGENOMiHOG000194860
HOVERGENiHBG001973
InParanoidiQ13190
KOiK08490
OMAiQDRTNEF
OrthoDBiEOG091G0HR8
PhylomeDBiQ13190
TreeFamiTF315068

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-5694530 Cargo concentration in the ER
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811438 Intra-Golgi traffic

Miscellaneous databases

ChiTaRSiSTX5 human
EvolutionaryTraceiQ13190
GeneWikiiSTX5
GenomeRNAii6811
PROiPR:Q13190
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162236 Expressed in 93 organ(s), highest expression level in blood
CleanExiHS_STX5
ExpressionAtlasiQ13190 baseline and differential
GenevisibleiQ13190 HS

Family and domain databases

InterProiView protein in InterPro
IPR010989 SNARE
IPR021538 Syntaxin-5_N
IPR006012 Syntaxin/epimorphin_CS
IPR000727 T_SNARE_dom
PfamiView protein in Pfam
PF05739 SNARE, 1 hit
PF11416 Syntaxin-5_N, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 1 hit
SUPFAMiSSF47661 SSF47661, 1 hit
PROSITEiView protein in PROSITE
PS00914 SYNTAXIN, 1 hit
PS50192 T_SNARE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTX5_HUMAN
AccessioniPrimary (citable) accession number: Q13190
Secondary accession number(s): B2R8T2
, F8W8Q9, Q5U0D4, Q7Z3T6, Q9BUG1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 5, 2006
Last modified: September 12, 2018
This is version 171 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again