Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 13 member 2

Gene

SLC13A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Cotransport of sodium ions and dicarboxylates such as succinate and citrate.

GO - Molecular functioni

Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Enzyme and pathway databases

ReactomeiR-HSA-433137 Sodium-coupled sulphate, di- and tri-carboxylate transporters

Protein family/group databases

TCDBi2.A.47.1.17 the divalent anion:na(+) symporter (dass) family

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 13 member 2
Alternative name(s):
Na(+)/dicarboxylate cotransporter 1
Short name:
NaDC-1
Renal sodium/dicarboxylate cotransporter
Gene namesi
Name:SLC13A2
Synonyms:NADC1, SDCT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000007216.14
HGNCiHGNC:10917 SLC13A2
MIMi604148 gene
neXtProtiNX_Q13183

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei13 – 33HelicalSequence analysisAdd BLAST21
Transmembranei53 – 73HelicalSequence analysisAdd BLAST21
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Transmembranei114 – 134HelicalSequence analysisAdd BLAST21
Transmembranei221 – 241HelicalSequence analysisAdd BLAST21
Transmembranei274 – 294HelicalSequence analysisAdd BLAST21
Transmembranei324 – 344HelicalSequence analysisAdd BLAST21
Transmembranei371 – 391HelicalSequence analysisAdd BLAST21
Transmembranei450 – 470HelicalSequence analysisAdd BLAST21
Transmembranei482 – 502HelicalSequence analysisAdd BLAST21
Transmembranei511 – 531HelicalSequence analysisAdd BLAST21
Transmembranei545 – 565HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9058
OpenTargetsiENSG00000007216
PharmGKBiPA382

Chemistry databases

ChEMBLiCHEMBL3712851
DrugBankiDB00139 Succinic acid

Polymorphism and mutation databases

BioMutaiSLC13A2
DMDMi2499523

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001724881 – 592Solute carrier family 13 member 2Add BLAST592

Proteomic databases

PeptideAtlasiQ13183
PRIDEiQ13183
ProteomicsDBi59209

PTM databases

iPTMnetiQ13183
PhosphoSitePlusiQ13183

Expressioni

Gene expression databases

BgeeiENSG00000007216 Expressed in 81 organ(s), highest expression level in duodenum
CleanExiHS_SLC13A2
ExpressionAtlasiQ13183 baseline and differential
GenevisibleiQ13183 HS

Organism-specific databases

HPAiHPA014963

Interactioni

Protein-protein interaction databases

BioGridi114520, 14 interactors
IntActiQ13183, 2 interactors

Chemistry databases

BindingDBiQ13183

Structurei

3D structure databases

ProteinModelPortaliQ13183
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00550000074480
HOGENOMiHOG000278432
HOVERGENiHBG055339
InParanoidiQ13183
KOiK14445
OMAiIWWMTEA
OrthoDBiEOG091G092X
PhylomeDBiQ13183
TreeFamiTF312913

Family and domain databases

InterProiView protein in InterPro
IPR031312 Na/sul_symport_CS
IPR001898 SLC13A/DASS
PfamiView protein in Pfam
PF00939 Na_sulph_symp, 1 hit
PROSITEiView protein in PROSITE
PS01271 NA_SULFATE, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13183-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATCWQALWA YRSYLIVFFV PILLLPLPIL VPSKEAYCAY AIILMALFWC
60 70 80 90 100
TEALPLAVTA LFPLILFPMM GIVDASEVAV EYLKDSNLLF FGGLLVAIAV
110 120 130 140 150
EHWNLHKRIA LRVLLIVGVR PAPLILGFML VTAFLSMWIS NTATSAMMVP
160 170 180 190 200
IAHAVLDQLH SSQASSNVEE GSNNPTFELQ EPSPQKEVTK LDNGQALPVT
210 220 230 240 250
SASSEGRAHL SQKHLHLTQC MSLCVCYSAS IGGIATLTGT APNLVLQGQI
260 270 280 290 300
NSLFPQNGNV VNFASWFSFA FPTMVILLLL AWLWLQILFL GFNFRKNFGI
310 320 330 340 350
GEKMQEQQQA AYCVIQTEHR LLGPMTFAEK AISILFVILV LLWFTREPGF
360 370 380 390 400
FLGWGNLAFP NAKGESMVSD GTVAIFIGII MFIIPSKFPG LTQDPENPGK
410 420 430 440 450
LKAPLGLLDW KTVNQKMPWN IVLLLGGGYA LAKGSERSGL SEWLGNKLTP
460 470 480 490 500
LQSVPAPAIA IILSLLVATF TECTSNVATT TIFLPILASM AQAICLHPLY
510 520 530 540 550
VMLPCTLATS LAFMLPVATP PNAIVFSFGD LKVLDMARAG FLLNIIGVLI
560 570 580 590
IALAINSWGI PLFSLHSFPS WAQSNTTAQC LPSLANTTTP SP
Length:592
Mass (Da):64,410
Last modified:November 1, 1996 - v1
Checksum:i41137D6621A0872A
GO
Isoform 2 (identifier: Q13183-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: Missing.
     77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ

Note: No experimental confirmation available.
Show »
Length:597
Mass (Da):64,468
Checksum:i51635628BF7A3AC3
GO
Isoform 3 (identifier: Q13183-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ

Note: No experimental confirmation available.
Show »
Length:641
Mass (Da):69,525
Checksum:iFC95202C8D82D238
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GWV6F5GWV6_HUMAN
Solute carrier family 13 member 2
SLC13A2
358Annotation score:
J3QLA5J3QLA5_HUMAN
Solute carrier family 13 member 2
SLC13A2
35Annotation score:
J3QR70J3QR70_HUMAN
Solute carrier family 13 member 2
SLC13A2
27Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti307Q → R in BAG60623 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02925444L → F. Corresponds to variant dbSNP:rs45443898Ensembl.1
Natural variantiVAR_05200045M → L. Corresponds to variant dbSNP:rs16964363Ensembl.1
Natural variantiVAR_029255254F → L. Corresponds to variant dbSNP:rs11568461Ensembl.1
Natural variantiVAR_029256310A → P. Corresponds to variant dbSNP:rs11568441Ensembl.1
Natural variantiVAR_020399385P → S. Corresponds to variant dbSNP:rs45546232Ensembl.1
Natural variantiVAR_029257477V → M. Corresponds to variant dbSNP:rs11568476Ensembl.1
Natural variantiVAR_020400550I → V2 PublicationsCorresponds to variant dbSNP:rs11567842Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0464261 – 44Missing in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_04642777E → EIIQRPFPSSFESPGECQSV GMSVTASHNLGGTVGDSRVF PPLSHVSTCQ in isoform 2 and isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26209 mRNA Translation: AAA98504.1
AK298388 mRNA Translation: BAG60623.1
AK314684 mRNA Translation: BAG37236.1
AC015917 Genomic DNA No translation available.
BC096277 mRNA Translation: AAH96277.1
BC096278 mRNA Translation: AAH96278.1
BC096279 mRNA Translation: AAH96279.1
CCDSiCCDS11231.1 [Q13183-1]
CCDS54098.1 [Q13183-3]
RefSeqiNP_001139447.1, NM_001145975.1 [Q13183-3]
NP_003975.1, NM_003984.3 [Q13183-1]
UniGeneiHs.102307

Genome annotation databases

EnsembliENST00000314669; ENSP00000316202; ENSG00000007216 [Q13183-1]
ENST00000444914; ENSP00000392411; ENSG00000007216 [Q13183-3]
GeneIDi9058
KEGGihsa:9058
UCSCiuc002hbh.4 human [Q13183-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26209 mRNA Translation: AAA98504.1
AK298388 mRNA Translation: BAG60623.1
AK314684 mRNA Translation: BAG37236.1
AC015917 Genomic DNA No translation available.
BC096277 mRNA Translation: AAH96277.1
BC096278 mRNA Translation: AAH96278.1
BC096279 mRNA Translation: AAH96279.1
CCDSiCCDS11231.1 [Q13183-1]
CCDS54098.1 [Q13183-3]
RefSeqiNP_001139447.1, NM_001145975.1 [Q13183-3]
NP_003975.1, NM_003984.3 [Q13183-1]
UniGeneiHs.102307

3D structure databases

ProteinModelPortaliQ13183
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114520, 14 interactors
IntActiQ13183, 2 interactors

Chemistry databases

BindingDBiQ13183
ChEMBLiCHEMBL3712851
DrugBankiDB00139 Succinic acid

Protein family/group databases

TCDBi2.A.47.1.17 the divalent anion:na(+) symporter (dass) family

PTM databases

iPTMnetiQ13183
PhosphoSitePlusiQ13183

Polymorphism and mutation databases

BioMutaiSLC13A2
DMDMi2499523

Proteomic databases

PeptideAtlasiQ13183
PRIDEiQ13183
ProteomicsDBi59209

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314669; ENSP00000316202; ENSG00000007216 [Q13183-1]
ENST00000444914; ENSP00000392411; ENSG00000007216 [Q13183-3]
GeneIDi9058
KEGGihsa:9058
UCSCiuc002hbh.4 human [Q13183-1]

Organism-specific databases

CTDi9058
DisGeNETi9058
EuPathDBiHostDB:ENSG00000007216.14
GeneCardsiSLC13A2
HGNCiHGNC:10917 SLC13A2
HPAiHPA014963
MIMi604148 gene
neXtProtiNX_Q13183
OpenTargetsiENSG00000007216
PharmGKBiPA382
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00550000074480
HOGENOMiHOG000278432
HOVERGENiHBG055339
InParanoidiQ13183
KOiK14445
OMAiIWWMTEA
OrthoDBiEOG091G092X
PhylomeDBiQ13183
TreeFamiTF312913

Enzyme and pathway databases

ReactomeiR-HSA-433137 Sodium-coupled sulphate, di- and tri-carboxylate transporters

Miscellaneous databases

GeneWikiiSLC13A2
GenomeRNAii9058
PROiPR:Q13183
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000007216 Expressed in 81 organ(s), highest expression level in duodenum
CleanExiHS_SLC13A2
ExpressionAtlasiQ13183 baseline and differential
GenevisibleiQ13183 HS

Family and domain databases

InterProiView protein in InterPro
IPR031312 Na/sul_symport_CS
IPR001898 SLC13A/DASS
PfamiView protein in Pfam
PF00939 Na_sulph_symp, 1 hit
PROSITEiView protein in PROSITE
PS01271 NA_SULFATE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiS13A2_HUMAN
AccessioniPrimary (citable) accession number: Q13183
Secondary accession number(s): B2RBI9
, B4DPL1, E7ETH5, Q4VAR7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again