Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

S-methyl-5'-thioadenosine phosphorylase

Gene

MTAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.UniRule annotation1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by 5'-methylthiotubercin and 5'-chloroformycin.

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=5 µM for S-methyl-5'-thioadenosine2 Publications
  2. KM=580 µM for phosphate2 Publications
  3. KM=23 µM for adenine2 Publications
  4. KM=8 µM for S-methyl-5-thio-alpha-D-ribose 1-phosphate2 Publications

    pH dependencei

    Optimum pH is 7.2-7.6.2 Publications

    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: L-methionine biosynthesis via salvage pathway

    This protein is involved in step 1 of the subpathway that synthesizes S-methyl-5-thio-alpha-D-ribose 1-phosphate from S-methyl-5'-thioadenosine (phosphorylase route).UniRule annotation
    Proteins known to be involved in this subpathway in this organism are:
    1. S-methyl-5'-thioadenosine phosphorylase (MTAP), S-methyl-5'-thioadenosine phosphorylase (MTAP-ANRIL fusion), S-methyl-5'-thioadenosine phosphorylase (MTAP), S-methyl-5'-thioadenosine phosphorylase (MTAP)
    This subpathway is part of the pathway L-methionine biosynthesis via salvage pathway, which is itself part of Amino-acid biosynthesis.
    View all proteins of this organism that are known to be involved in the subpathway that synthesizes S-methyl-5-thio-alpha-D-ribose 1-phosphate from S-methyl-5'-thioadenosine (phosphorylase route), the pathway L-methionine biosynthesis via salvage pathway and in Amino-acid biosynthesis.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei18Phosphate1
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei178Important for substrate specificity1
    Binding sitei196Substrate; via amide nitrogen1
    Binding sitei197Phosphate1
    Sitei233Important for substrate specificity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    • phosphorylase activity Source: ProtInc
    • S-methyl-5-thioadenosine phosphorylase activity Source: GO_Central

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    Biological processPurine salvage

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:HS01913-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    2.4.2.28 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-1237112 Methionine salvage pathway
    R-HSA-8950505 Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q13126

    SignaLink: a signaling pathway resource with multi-layered regulatory networks

    More...
    SignaLinki
    Q13126

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00904;UER00873

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    S-methyl-5'-thioadenosine phosphorylaseUniRule annotation (EC:2.4.2.28UniRule annotation)
    Alternative name(s):
    5'-methylthioadenosine phosphorylaseUniRule annotation
    Short name:
    MTA phosphorylaseUniRule annotation
    Short name:
    MTAPUniRule annotation
    Short name:
    MTAPaseUniRule annotation
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:MTAPUniRule annotation
    Synonyms:MSAP
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000099810.18

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:7413 MTAP

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    156540 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q13126

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Diaphyseal medullary stenosis with malignant fibrous histiocytoma (DMSMFH)1 Publication
    The disease is caused by mutations affecting the gene represented in this entry. DMSMFH causing mutations found in MTAP exon 9 result in exon skipping and dysregulated alternative splicing of all MTAP isoforms (PubMed:22464254).1 Publication
    Disease descriptionAn autosomal dominant bone dysplasia characterized by pathologic fractures due to abnormal cortical growth and diaphyseal medullary stenosis. The fractures heal poorly, and there is progressive bowing of the lower extremities. Some patients show a limb-girdle myopathy, with muscle weakness and atrophy. Approximately 35% of affected individuals develop an aggressive form of bone sarcoma consistent with malignant fibrous histiocytoma or osteosarcoma.
    See also OMIM:112250
    Loss of MTAP activity may play a role in human cancer. MTAP loss has been reported in a number of cancers, including osteosarcoma, malignant melanoma and gastric cancer.

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    4507

    MalaCards human disease database

    More...
    MalaCardsi
    MTAP
    MIMi112250 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000099810

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    85182 Diaphyseal medullary stenosis-bone malignancy syndrome

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA31220

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL4941

    Drug and drug target database

    More...
    DrugBanki
    DB02933 5'-Deoxy-5'-(Methylthio)-Tubercidin
    DB02282 5'-Deoxy-5'-Methylthioadenosine
    DB00173 Adenine
    DB02281 Formycin

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    MTAP

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    143811423

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001845451 – 283S-methyl-5'-thioadenosine phosphorylaseAdd BLAST283

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei51N6-acetyllysineBy similarity1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q13126

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q13126

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q13126

    PeptideAtlas

    More...
    PeptideAtlasi
    Q13126

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q13126

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    59174

    2D gel databases

    REPRODUCTION-2DPAGE

    More...
    REPRODUCTION-2DPAGEi
    Q13126

    University College Dublin 2-DE Proteome Database

    More...
    UCD-2DPAGEi
    Q13126

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q13126

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q13126

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Ubiquitously expressed.

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000099810 Expressed in 192 organ(s), highest expression level in adrenal tissue

    CleanEx database of gene expression profiles

    More...
    CleanExi
    HS_MTAP

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q13126 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q13126 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA046915

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homotrimer.UniRule annotation5 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    WithEntry#Exp.IntActNotes
    CENPHQ9H3R53EBI-2547776,EBI-1003700

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    110611, 50 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q13126, 14 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q13126

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000369519

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q13126

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1283
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    Q13126

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q13126

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    Q13126

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni60 – 61Phosphate binding2
    Regioni93 – 94Phosphate binding2
    Regioni220 – 222Substrate binding3

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.UniRule annotation

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3985 Eukaryota
    COG0005 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00550000074874

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000228986

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG002487

    KEGG Orthology (KO)

    More...
    KOi
    K00772

    Database of Orthologous Groups

    More...
    OrthoDBi
    EOG091G0CQI

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q13126

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF312883

    Family and domain databases

    HAMAP database of protein families

    More...
    HAMAPi
    MF_01963 MTAP, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR010044 MTAP
    IPR000845 Nucleoside_phosphorylase_d
    IPR035994 Nucleoside_phosphorylase_sf
    IPR018099 Purine_phosphorylase-2_CS

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR42679 PTHR42679, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF01048 PNP_UDP_1, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF53167 SSF53167, 1 hit

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR01694 MTAP, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS01240 PNP_MTAP_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q13126-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MASGTTTTAV KIGIIGGTGL DDPEILEGRT EKYVDTPFGK PSDALILGKI
    60 70 80 90 100
    KNVDCVLLAR HGRQHTIMPS KVNYQANIWA LKEEGCTHVI VTTACGSLRE
    110 120 130 140 150
    EIQPGDIVII DQFIDRTTMR PQSFYDGSHS CARGVCHIPM AEPFCPKTRE
    160 170 180 190 200
    VLIETAKKLG LRCHSKGTMV TIEGPRFSSR AESFMFRTWG ADVINMTTVP
    210 220 230 240 250
    EVVLAKEAGI CYASIAMATD YDCWKEHEEA VSVDRVLKTL KENANKAKSL
    260 270 280
    LLTTIPQIGS TEWSETLHNL KNMAQFSVLL PRH
    Length:283
    Mass (Da):31,236
    Last modified:April 3, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3B34C565EB5B99DA
    GO
    Isoform 2 (identifier: Q13126-2) [UniParc]FASTAAdd to basket
    Also known as: MTAP_v1

    The sequence of this isoform differs from the canonical sequence as follows:
         272-283: NMAQFSVLLPRH → MIKFQMILSE...KDQTYICMKS

    Show »
    Length:346
    Mass (Da):38,356
    Checksum:i1681DA9B0DFB66EE
    GO
    Isoform 3 (identifier: Q13126-3) [UniParc]FASTAAdd to basket
    Also known as: MTAP_v2

    The sequence of this isoform differs from the canonical sequence as follows:
         272-283: NMAQFSVLLPRH → MIKFQMILSEGYHPFNIQESPFYRGLLDFPSVGHGRGEILPLSPLDLAGYCFQQPMQPPCPDS

    Show »
    Length:334
    Mass (Da):36,936
    Checksum:i3CD3E1A173FC3465
    GO
    Isoform 4 (identifier: Q13126-4) [UniParc]FASTAAdd to basket
    Also known as: MTAP_v3

    The sequence of this isoform differs from the canonical sequence as follows:
         272-283: NMAQFSVLLPRH → VRSAFQLPP

    Show »
    Length:280
    Mass (Da):30,838
    Checksum:i68C30E7ABA7B8AB6
    GO
    Isoform 5 (identifier: Q13126-5) [UniParc]FASTAAdd to basket
    Also known as: MTAP_v4

    The sequence of this isoform differs from the canonical sequence as follows:
         231-283: VSVDRVLKTL...AQFSVLLPRH → MIKFQMILSE...KDQTYICMKS

    Show »
    Length:305
    Mass (Da):33,797
    Checksum:iD50D41EC7E7123EB
    GO
    Isoform 6 (identifier: Q13126-6) [UniParc]FASTAAdd to basket
    Also known as: MTAP_v5

    The sequence of this isoform differs from the canonical sequence as follows:
         231-283: VSVDRVLKTL...AQFSVLLPRH → MIKFQMILSE...QPMQPPCPDS

    Show »
    Length:293
    Mass (Da):32,376
    Checksum:i3968FB0DFD63A981
    GO
    Isoform 7 (identifier: Q13126-7) [UniParc]FASTAAdd to basket
    Also known as: MTAP_v6

    The sequence of this isoform differs from the canonical sequence as follows:
         232-283: SVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH → RSAFQLPP

    Show »
    Length:239
    Mass (Da):26,278
    Checksum:iDD08ECE4DF322F02
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    B4DUC8B4DUC8_HUMAN
    S-methyl-5'-thioadenosine phosphory...
    MTAP
    300Annotation score:

    Annotation score:3 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    J3QSB7J3QSB7_HUMAN
    Purine nucleoside phosphorylase
    MTAP
    242Annotation score:

    Annotation score:3 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    J3KRN1J3KRN1_HUMAN
    S-methyl-5'-thioadenosine phosphory...
    MTAP
    112Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8WES2F8WES2_HUMAN
    S-methyl-5'-thioadenosine phosphory...
    MTAP
    50Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A2R8Y4K0A0A2R8Y4K0_HUMAN
    S-methyl-5'-thioadenosine phosphory...
    MTAP
    55Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti218A → G in AAG38871 (PubMed:8650244).Curated1
    Sequence conflicti218A → G in AAR24607 (PubMed:8650244).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03147056V → I3 PublicationsCorresponds to variant dbSNP:rs7023954EnsemblClinVar.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044071231 – 283VSVDR…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGKKC LSAPAIILRPPQPRGTVTTF KVSWSKDQTYICMKS in isoform 5. 1 PublicationAdd BLAST53
    Alternative sequenceiVSP_044072231 – 283VSVDR…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGEIL PLSPLDLAGYCFQQPMQPPC PDS in isoform 6. 1 PublicationAdd BLAST53
    Alternative sequenceiVSP_044073232 – 283SVDRV…LLPRH → RSAFQLPP in isoform 7. 1 PublicationAdd BLAST52
    Alternative sequenceiVSP_044074272 – 283NMAQF…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGKKC LSAPAIILRPPQPRGTVTTF KVSWSKDQTYICMKS in isoform 2. 1 PublicationAdd BLAST12
    Alternative sequenceiVSP_044075272 – 283NMAQF…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGEIL PLSPLDLAGYCFQQPMQPPC PDS in isoform 3. 1 PublicationAdd BLAST12
    Alternative sequenceiVSP_044076272 – 283NMAQF…LLPRH → VRSAFQLPP in isoform 4. 1 PublicationAdd BLAST12

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    U22233 mRNA Translation: AAA81646.1
    L40432 mRNA Translation: AAG38871.1
    L42634
    , L42627, L42628, L42629, L42630, L42631, L42632, L42633 Genomic DNA Translation: AAR24607.2
    HE654772 mRNA Translation: CCF77345.1
    HE654773 mRNA Translation: CCF77346.1
    HE654774 mRNA Translation: CCF77347.1
    HE654775 mRNA Translation: CCF77348.1
    HE654776 mRNA Translation: CCF77349.1
    HE654777 mRNA Translation: CCF77350.1
    AY712791 mRNA Translation: AAU04442.1
    AL359922 Genomic DNA No translation available.
    CH471071 Genomic DNA Translation: EAW58606.1
    BC026106 mRNA Translation: AAH26106.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS6509.1 [Q13126-1]

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    I38969

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_002442.2, NM_002451.3 [Q13126-1]

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.193268

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000380172; ENSP00000369519; ENSG00000099810 [Q13126-1]
    ENST00000580900; ENSP00000463424; ENSG00000099810 [Q13126-3]
    ENST00000644715; ENSP00000494373; ENSG00000099810 [Q13126-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    4507

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:4507

    UCSC genome browser

    More...
    UCSCi
    uc003zph.4 human [Q13126-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    U22233 mRNA Translation: AAA81646.1
    L40432 mRNA Translation: AAG38871.1
    L42634
    , L42627, L42628, L42629, L42630, L42631, L42632, L42633 Genomic DNA Translation: AAR24607.2
    HE654772 mRNA Translation: CCF77345.1
    HE654773 mRNA Translation: CCF77346.1
    HE654774 mRNA Translation: CCF77347.1
    HE654775 mRNA Translation: CCF77348.1
    HE654776 mRNA Translation: CCF77349.1
    HE654777 mRNA Translation: CCF77350.1
    AY712791 mRNA Translation: AAU04442.1
    AL359922 Genomic DNA No translation available.
    CH471071 Genomic DNA Translation: EAW58606.1
    BC026106 mRNA Translation: AAH26106.1
    CCDSiCCDS6509.1 [Q13126-1]
    PIRiI38969
    RefSeqiNP_002442.2, NM_002451.3 [Q13126-1]
    UniGeneiHs.193268

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    1CB0X-ray1.70A1-283[»]
    1CG6X-ray1.70A1-283[»]
    1K27X-ray1.95A1-283[»]
    1SD1X-ray2.03A1-283[»]
    1SD2X-ray2.10A1-283[»]
    3LN5X-ray1.90C227-237[»]
    3OZCX-ray1.93A1-283[»]
    3OZDX-ray2.10A/B1-283[»]
    3OZEX-ray2.00A/B/C/D/E/F1-283[»]
    5EUBX-ray1.81A1-283[»]
    5TC5X-ray1.96A/B/C1-283[»]
    5TC6X-ray1.48A1-283[»]
    5TC7X-ray1.75A1-283[»]
    5TC8X-ray1.80A1-283[»]
    ProteinModelPortaliQ13126
    SMRiQ13126
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi110611, 50 interactors
    IntActiQ13126, 14 interactors
    MINTiQ13126
    STRINGi9606.ENSP00000369519

    Chemistry databases

    BindingDBiQ13126
    ChEMBLiCHEMBL4941
    DrugBankiDB02933 5'-Deoxy-5'-(Methylthio)-Tubercidin
    DB02282 5'-Deoxy-5'-Methylthioadenosine
    DB00173 Adenine
    DB02281 Formycin

    PTM databases

    iPTMnetiQ13126
    PhosphoSitePlusiQ13126

    Polymorphism and mutation databases

    BioMutaiMTAP
    DMDMi143811423

    2D gel databases

    REPRODUCTION-2DPAGEiQ13126
    UCD-2DPAGEiQ13126

    Proteomic databases

    EPDiQ13126
    MaxQBiQ13126
    PaxDbiQ13126
    PeptideAtlasiQ13126
    PRIDEiQ13126
    ProteomicsDBi59174

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    4507
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000380172; ENSP00000369519; ENSG00000099810 [Q13126-1]
    ENST00000580900; ENSP00000463424; ENSG00000099810 [Q13126-3]
    ENST00000644715; ENSP00000494373; ENSG00000099810 [Q13126-1]
    GeneIDi4507
    KEGGihsa:4507
    UCSCiuc003zph.4 human [Q13126-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    4507
    DisGeNETi4507
    EuPathDBiHostDB:ENSG00000099810.18

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    MTAP

    H-Invitational Database, human transcriptome db

    More...
    H-InvDBi
    HIX0007954
    HIX0025895
    HGNCiHGNC:7413 MTAP
    HPAiHPA046915
    MalaCardsiMTAP
    MIMi112250 phenotype
    156540 gene
    neXtProtiNX_Q13126
    OpenTargetsiENSG00000099810
    Orphaneti85182 Diaphyseal medullary stenosis-bone malignancy syndrome
    PharmGKBiPA31220

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG3985 Eukaryota
    COG0005 LUCA
    GeneTreeiENSGT00550000074874
    HOGENOMiHOG000228986
    HOVERGENiHBG002487
    KOiK00772
    OrthoDBiEOG091G0CQI
    PhylomeDBiQ13126
    TreeFamiTF312883

    Enzyme and pathway databases

    UniPathwayi
    UPA00904;UER00873

    BioCyciMetaCyc:HS01913-MONOMER
    BRENDAi2.4.2.28 2681
    ReactomeiR-HSA-1237112 Methionine salvage pathway
    R-HSA-8950505 Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
    SABIO-RKiQ13126
    SignaLinkiQ13126

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    MTAP human
    EvolutionaryTraceiQ13126

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    MTAP

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    4507

    Protein Ontology

    More...
    PROi
    PR:Q13126

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000099810 Expressed in 192 organ(s), highest expression level in adrenal tissue
    CleanExiHS_MTAP
    ExpressionAtlasiQ13126 baseline and differential
    GenevisibleiQ13126 HS

    Family and domain databases

    HAMAPiMF_01963 MTAP, 1 hit
    InterProiView protein in InterPro
    IPR010044 MTAP
    IPR000845 Nucleoside_phosphorylase_d
    IPR035994 Nucleoside_phosphorylase_sf
    IPR018099 Purine_phosphorylase-2_CS
    PANTHERiPTHR42679 PTHR42679, 1 hit
    PfamiView protein in Pfam
    PF01048 PNP_UDP_1, 1 hit
    SUPFAMiSSF53167 SSF53167, 1 hit
    TIGRFAMsiTIGR01694 MTAP, 1 hit
    PROSITEiView protein in PROSITE
    PS01240 PNP_MTAP_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTAP_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13126
    Secondary accession number(s): I2G7M5
    , I2G7M6, I2G7M7, I2G7M8, I2G7M9, I2G7N0, Q5T3P3, Q9H010
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: April 3, 2007
    Last modified: December 5, 2018
    This is version 192 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    7. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again