Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q13098 (CSN1_HUMAN)

Entry version 197 (07 Apr 2021)
Sequence version 4 (10 Feb 2009)
Previous versions | rss
Add a publicationFeedback
Protein

COP9 signalosome complex subunit 1

Gene

GPS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Suppresses G-protein- and mitogen-activated protein kinase-mediated signal transduction.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q13098

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5696394, DNA Damage Recognition in GG-NER
R-HSA-6781823, Formation of TC-NER Pre-Incision Complex
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8951664, Neddylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
COP9 signalosome complex subunit 1
Short name:
SGN1
Short name:
Signalosome subunit 1
Alternative name(s):
G protein pathway suppressor 1
Short name:
GPS-1
JAB1-containing signalosome subunit 1
Protein MFH
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPS1
Synonyms:COPS1, CSN1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4549, GPS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601934, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q13098

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000169727.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus, Signalosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		2873

Open Targets

More...OpenTargetsi		ENSG00000169727

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28944

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q13098, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GPS1

Domain mapping of disease mutations (DMDM)

More...DMDMi		223590263

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001209592 – 491COP9 signalosome complex subunit 1Add BLAST490

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei468PhosphoserineCombined sources1 Publication1
Modified residuei474PhosphoserineCombined sources1 Publication1
Modified residuei479PhosphothreonineCombined sources1 Publication1
Modified residuei483PhosphoserineCombined sources1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q13098

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q13098

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q13098

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q13098

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q13098

PeptideAtlas

More...PeptideAtlasi		Q13098

PRoteomics IDEntifications database

More...PRIDEi		Q13098

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		59147 [Q13098-4]
59148 [Q13098-5]
59149 [Q13098-6]
59150 [Q13098-7]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q13098-5 [Q13098-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q13098

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q13098

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q13098

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q13098

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169727, Expressed in cerebellar vermis and 221 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q13098, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q13098, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000169727, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:11337588, PubMed:18850735, PubMed:26456823). In the complex, it probably interacts directly with COPS2, COPS3, COPS4 and COPS5 (PubMed:11114242).

Interacts directly with inositol kinase ITPK1 (PubMed:12324474).

Interacts with CAPN8 (By similarity).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109131, 103 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-1870, COP9 signalosome variant 1
CPX-1871, COP9 signalosome variant 2

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q13098

Database of interacting proteins

More...DIPi		DIP-42077N

Protein interaction database and analysis system

More...IntActi		Q13098, 56 interactors

Molecular INTeraction database

More...MINTi		Q13098

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000376167

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q13098, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q13098

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini269 – 431PCIPROSITE-ProRule annotationAdd BLAST163

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PCI domain is necessary and sufficient for the interactions with other CSN subunits of the complex. Mediates the interaction with CAPN8 (By similarity).By similarity
The N-terminal part (1-216), which is not required for deneddylating activity and CSN complex formation, is nevertheless essential for other aspects of CSN complex function, such as repression of c-fos/FOS expression.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CSN1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0686, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00510000046608

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q13098

Identification of Orthologs from Complete Genome Data

More...OMAi		IYLQNWA

Database of Orthologous Groups

More...OrthoDBi		859626at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q13098

TreeFam database of animal gene trees

More...TreeFami		TF101167

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR033008, CSN1
IPR000717, PCI_dom
IPR019585, Rpn7/CSN1
IPR036390, WH_DNA-bd_sf

The PANTHER Classification System

More...PANTHERi		PTHR14145:SF2, PTHR14145:SF2, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01399, PCI, 1 hit
PF10602, RPN7, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00088, PINT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46785, SSF46785, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50250, PCI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q13098-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLPVQVFNL QGAVEPMQID VDPQEDPQNA PDVNYVVENP SLDLEQYAAS 
        60         70         80         90        100
YSGLMRIERL QFIADHCPTL RVEALKMALS FVQRTFNVDM YEEIHRKLSE 
       110        120        130        140        150
ATRSSLRELQ NAPDAIPESG VEPPALDTAW VEATRKKALL KLEKLDTDLK 
       160        170        180        190        200
NYKGNSIKES IRRGHDDLGD HYLDCGDLSN ALKCYSRARD YCTSAKHVIN 
       210        220        230        240        250
MCLNVIKVSV YLQNWSHVLS YVSKAESTPE IAEQRGERDS QTQAILTKLK 
       260        270        280        290        300
CAAGLAELAA RKYKQAAKCL LLASFDHCDF PELLSPSNVA IYGGLCALAT 
       310        320        330        340        350
FDRQELQRNV ISSSSFKLFL ELEPQVRDII FKFYESKYAS CLKMLDEMKD 
       360        370        380        390        400
NLLLDMYLAP HVRTLYTQIR NRALIQYFSP YVSADMHRMA AAFNTTVAAL 
       410        420        430        440        450
EDELTQLILE GLISARVDSH SKILYARDVD QRSTTFEKSL LMGKEFQRRA 
       460        470        480        490 
KAMMLRAAVL RNQIHVKSPP REGSQGELTP ANSQSRMSTN M
Length:491
Mass (Da):55,537
Last modified:February 10, 2009 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBF925164ED985638
GO
Isoform 4 (identifier: Q13098-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-106: Missing.

Show »
Length:487
Mass (Da):55,093
Checksum:i8E706F5C8E4763A5
GO
Isoform 3 (identifier: Q13098-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-109: GAVEPMQIDV...EATRSSLREL → PASSVSGSGG...QIDVDPQEDP
     471-491: REGSQGELTPANSQSRMSTNM → TSTDLGPPGG...VRCRQVGGVH

Show »
Length:549
Mass (Da):59,818
Checksum:iB0C46F7860CB480E
GO
Isoform 2 (identifier: Q13098-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYE
     103-106: Missing.

Show »
Length:527
Mass (Da):59,050
Checksum:i6081BEBD48CAF32C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JFE4C9JFE4_HUMAN
COP9 signalosome complex subunit 1
GPS1 hCG_1987516
471Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A096LP07A0A096LP07_HUMAN
COP9 signalosome complex subunit 1
GPS1
486Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A096LPJ3A0A096LPJ3_HUMAN
COP9 signalosome complex subunit 1
GPS1
490Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8K070A8K070_HUMAN
COP9 signalosome complex subunit 1
GPS1
526Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRJ4J3KRJ4_HUMAN
COP9 signalosome complex subunit 1
GPS1
253Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQX0J3QQX0_HUMAN
COP9 signalosome complex subunit 1
GPS1
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSA5J3KSA5_HUMAN
COP9 signalosome complex subunit 1
GPS1
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLT0J3QLT0_HUMAN
COP9 signalosome complex subunit 1
GPS1
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTB0J3KTB0_HUMAN
COP9 signalosome complex subunit 1
GPS1
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRE8J3KRE8_HUMAN
COP9 signalosome complex subunit 1
GPS1
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC50906 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti259A → T in BAC04120 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0362401 – 11MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCT PHSSRSDLVLPGTAGDFSLS ASLSACTLLYE in isoform 2. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_03624112 – 109GAVEP…SLREL → PASSVSGSGGAESQDRMRDS SAPSSASSSVTDLYCTPHSS RSDLVLPGMAGDFSLSASLS ACTLLYEGAVEPMQIDVDPQ EDP in isoform 3. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_036242103 – 106Missing in isoform 2 and isoform 4. 2 Publications4
Alternative sequenceiVSP_011882471 – 491REGSQ…MSTNM → TSTDLGPPGGSVLPAAQLRG LATGCHPACVPSLGLRRQAA ASCGPSWKERPAGLDPVGFC PQGADCAAPRPSGTISQTPP VPASVRCRQVGGVH in isoform 3. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U20285 mRNA Translation: AAC50906.2 Different initiation.
AK093283 mRNA Translation: BAC04120.1
AC135056 Genomic DNA No translation available.
BC000155 mRNA Translation: AAH00155.3
BC064503 mRNA Translation: AAH64503.1
BT009834 mRNA Translation: AAP88836.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11800.1 [Q13098-7]
CCDS32774.1 [Q13098-4]
CCDS82226.1 [Q13098-5]

Protein sequence database of the Protein Information Resource

More...PIRi		G01646

NCBI Reference Sequences

More...RefSeqi		NP_001308021.1, NM_001321092.1 [Q13098-5]
NP_004118.3, NM_004127.5 [Q13098-4]
NP_997657.1, NM_212492.2 [Q13098-7]
XP_016880023.1, XM_017024534.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000306823; ENSP00000302873; ENSG00000169727 [Q13098-4]
ENST00000392358; ENSP00000376167; ENSG00000169727 [Q13098-7]
ENST00000578552; ENSP00000462265; ENSG00000169727 [Q13098-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2873

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2873

UCSC genome browser

More...UCSCi		uc002kdk.2, human [Q13098-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20285 mRNA Translation: AAC50906.2 Different initiation.
AK093283 mRNA Translation: BAC04120.1
AC135056 Genomic DNA No translation available.
BC000155 mRNA Translation: AAH00155.3
BC064503 mRNA Translation: AAH64503.1
BT009834 mRNA Translation: AAP88836.1
CCDSiCCDS11800.1 [Q13098-7]
CCDS32774.1 [Q13098-4]
CCDS82226.1 [Q13098-5]
PIRiG01646
RefSeqiNP_001308021.1, NM_001321092.1 [Q13098-5]
NP_004118.3, NM_004127.5 [Q13098-4]
NP_997657.1, NM_212492.2 [Q13098-7]
XP_016880023.1, XM_017024534.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4D10X-ray3.80A/I12-491[»]
4D18X-ray4.08A/I12-491[»]
4WSNX-ray5.50A/I/Q/Y/g/o12-491[»]
6R6Helectron microscopy8.40A1-491[»]
6R7Felectron microscopy8.20A37-469[»]
6R7Helectron microscopy8.80A37-469[»]
6R7Ielectron microscopy5.90A37-491[»]
6R7Nelectron microscopy6.50A1-491[»]
SMRiQ13098
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109131, 103 interactors
ComplexPortaliCPX-1870, COP9 signalosome variant 1
CPX-1871, COP9 signalosome variant 2
CORUMiQ13098
DIPiDIP-42077N
IntActiQ13098, 56 interactors
MINTiQ13098
STRINGi9606.ENSP00000376167

PTM databases

iPTMnetiQ13098
MetOSiteiQ13098
PhosphoSitePlusiQ13098
SwissPalmiQ13098

Genetic variation databases

BioMutaiGPS1
DMDMi223590263

Proteomic databases

EPDiQ13098
jPOSTiQ13098
MassIVEiQ13098
MaxQBiQ13098
PaxDbiQ13098
PeptideAtlasiQ13098
PRIDEiQ13098
ProteomicsDBi59147 [Q13098-4]
59148 [Q13098-5]
59149 [Q13098-6]
59150 [Q13098-7]
TopDownProteomicsiQ13098-5 [Q13098-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19873, 350 antibodies

The DNASU plasmid repository

More...DNASUi		2873

Genome annotation databases

EnsembliENST00000306823; ENSP00000302873; ENSG00000169727 [Q13098-4]
ENST00000392358; ENSP00000376167; ENSG00000169727 [Q13098-7]
ENST00000578552; ENSP00000462265; ENSG00000169727 [Q13098-5]
GeneIDi2873
KEGGihsa:2873
UCSCiuc002kdk.2, human [Q13098-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2873
DisGeNETi2873

GeneCards: human genes, protein and diseases

More...GeneCardsi		GPS1
HGNCiHGNC:4549, GPS1
HPAiENSG00000169727, Low tissue specificity
MIMi601934, gene
neXtProtiNX_Q13098
OpenTargetsiENSG00000169727
PharmGKBiPA28944
VEuPathDBiHostDB:ENSG00000169727.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0686, Eukaryota
GeneTreeiENSGT00510000046608
InParanoidiQ13098
OMAiIYLQNWA
OrthoDBi859626at2759
PhylomeDBiQ13098
TreeFamiTF101167

Enzyme and pathway databases

PathwayCommonsiQ13098
ReactomeiR-HSA-5696394, DNA Damage Recognition in GG-NER
R-HSA-6781823, Formation of TC-NER Pre-Incision Complex
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8951664, Neddylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2873, 702 hits in 1003 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GPS1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		GPS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2873
PharosiQ13098, Tbio

Protein Ontology

More...PROi		PR:Q13098
RNActiQ13098, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000169727, Expressed in cerebellar vermis and 221 other tissues
ExpressionAtlasiQ13098, baseline and differential
GenevisibleiQ13098, HS

Family and domain databases

InterProiView protein in InterPro
IPR033008, CSN1
IPR000717, PCI_dom
IPR019585, Rpn7/CSN1
IPR036390, WH_DNA-bd_sf
PANTHERiPTHR14145:SF2, PTHR14145:SF2, 1 hit
PfamiView protein in Pfam
PF01399, PCI, 1 hit
PF10602, RPN7, 1 hit
SMARTiView protein in SMART
SM00088, PINT, 1 hit
SUPFAMiSSF46785, SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS50250, PCI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCSN1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q13098
Secondary accession number(s): Q8NA10, Q9BWL1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 10, 2009
Last modified: April 7, 2021
This is version 197 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again