Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

COP9 signalosome complex subunit 1

Gene

GPS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Suppresses G-protein- and mitogen-activated protein kinase-mediated signal transduction.5 Publications

GO - Molecular functioni

  • GTPase inhibitor activity Source: ProtInc

GO - Biological processi

  • inactivation of MAPK activity Source: ProtInc
  • JNK cascade Source: ProtInc
  • nucleotide-excision repair, DNA damage recognition Source: Reactome
  • post-translational protein modification Source: Reactome
  • protein deneddylation Source: UniProtKB
  • transcription-coupled nucleotide-excision repair Source: Reactome

Enzyme and pathway databases

ReactomeiR-HSA-5696394 DNA Damage Recognition in GG-NER
R-HSA-6781823 Formation of TC-NER Pre-Incision Complex
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8951664 Neddylation

Names & Taxonomyi

Protein namesi
Recommended name:
COP9 signalosome complex subunit 1
Short name:
SGN1
Short name:
Signalosome subunit 1
Alternative name(s):
G protein pathway suppressor 1
Short name:
GPS-1
JAB1-containing signalosome subunit 1
Protein MFH
Gene namesi
Name:GPS1
Synonyms:COPS1, CSN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000169727.12
HGNCiHGNC:4549 GPS1
MIMi601934 gene
neXtProtiNX_Q13098

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Signalosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi2873
OpenTargetsiENSG00000169727
PharmGKBiPA28944

Polymorphism and mutation databases

BioMutaiGPS1
DMDMi223590263

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00001209592 – 491COP9 signalosome complex subunit 1Add BLAST490

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei468PhosphoserineCombined sources1 Publication1
Modified residuei474PhosphoserineCombined sources1 Publication1
Modified residuei479PhosphothreonineCombined sources1 Publication1
Modified residuei483PhosphoserineCombined sources1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ13098
MaxQBiQ13098
PaxDbiQ13098
PeptideAtlasiQ13098
PRIDEiQ13098
ProteomicsDBi59147
59148 [Q13098-5]
59149 [Q13098-6]
59150 [Q13098-7]
TopDownProteomicsiQ13098-5 [Q13098-5]

PTM databases

iPTMnetiQ13098
PhosphoSitePlusiQ13098
SwissPalmiQ13098

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000169727
CleanExiHS_GPS1
ExpressionAtlasiQ13098 baseline and differential
GenevisibleiQ13098 HS

Interactioni

Subunit structurei

Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:11337588, PubMed:18850735, PubMed:26456823). In the complex, it probably interacts directly with COPS2, COPS3, COPS4 and COPS5 (PubMed:11114242). Interacts directly with inositol kinase ITPK1 (PubMed:12324474). Interacts with CAPN8 (By similarity).By similarity5 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi109131, 83 interactors
ComplexPortaliCPX-1870 COP9 signalosome variant 1
CPX-1871 COP9 signalosome variant 2
CORUMiQ13098
DIPiDIP-42077N
IntActiQ13098, 37 interactors
MINTiQ13098
STRINGi9606.ENSP00000347251

Structurei

3D structure databases

ProteinModelPortaliQ13098
SMRiQ13098
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini269 – 431PCIPROSITE-ProRule annotationAdd BLAST163

Domaini

The PCI domain is necessary and sufficient for the interactions with other CSN subunits of the complex. Mediates the interaction with CAPN8 (By similarity).By similarity
The N-terminal part (1-216), which is not required for deneddylating activity and CSN complex formation, is nevertheless essential for other aspects of CSN complex function, such as repression of c-fos/FOS expression.1 Publication

Sequence similaritiesi

Belongs to the CSN1 family.Curated

Phylogenomic databases

eggNOGiKOG0686 Eukaryota
ENOG410XRXI LUCA
GeneTreeiENSGT00510000046608
HOGENOMiHOG000091977
HOVERGENiHBG030722
InParanoidiQ13098
KOiK12175
OMAiDMRKMAT
OrthoDBiEOG091G08AU
PhylomeDBiQ13098
TreeFamiTF101167

Family and domain databases

InterProiView protein in InterPro
IPR033008 CSN1
IPR000717 PCI_dom
IPR019585 Rpn7/CSN1
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR14145:SF2 PTHR14145:SF2, 1 hit
PfamiView protein in Pfam
PF01399 PCI, 1 hit
PF10602 RPN7, 1 hit
SMARTiView protein in SMART
SM00088 PINT, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS50250 PCI, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13098-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLPVQVFNL QGAVEPMQID VDPQEDPQNA PDVNYVVENP SLDLEQYAAS
60 70 80 90 100
YSGLMRIERL QFIADHCPTL RVEALKMALS FVQRTFNVDM YEEIHRKLSE
110 120 130 140 150
ATRSSLRELQ NAPDAIPESG VEPPALDTAW VEATRKKALL KLEKLDTDLK
160 170 180 190 200
NYKGNSIKES IRRGHDDLGD HYLDCGDLSN ALKCYSRARD YCTSAKHVIN
210 220 230 240 250
MCLNVIKVSV YLQNWSHVLS YVSKAESTPE IAEQRGERDS QTQAILTKLK
260 270 280 290 300
CAAGLAELAA RKYKQAAKCL LLASFDHCDF PELLSPSNVA IYGGLCALAT
310 320 330 340 350
FDRQELQRNV ISSSSFKLFL ELEPQVRDII FKFYESKYAS CLKMLDEMKD
360 370 380 390 400
NLLLDMYLAP HVRTLYTQIR NRALIQYFSP YVSADMHRMA AAFNTTVAAL
410 420 430 440 450
EDELTQLILE GLISARVDSH SKILYARDVD QRSTTFEKSL LMGKEFQRRA
460 470 480 490
KAMMLRAAVL RNQIHVKSPP REGSQGELTP ANSQSRMSTN M
Length:491
Mass (Da):55,537
Last modified:February 10, 2009 - v4
Checksum:iBF925164ED985638
GO
Isoform 4 (identifier: Q13098-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-106: Missing.

Show »
Length:487
Mass (Da):55,093
Checksum:i8E706F5C8E4763A5
GO
Isoform 3 (identifier: Q13098-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-109: GAVEPMQIDV...EATRSSLREL → PASSVSGSGG...QIDVDPQEDP
     471-491: REGSQGELTPANSQSRMSTNM → TSTDLGPPGG...VRCRQVGGVH

Note: No experimental confirmation available.
Show »
Length:549
Mass (Da):59,818
Checksum:iB0C46F7860CB480E
GO
Isoform 2 (identifier: Q13098-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYE
     103-106: Missing.

Show »
Length:527
Mass (Da):59,050
Checksum:i6081BEBD48CAF32C
GO

Sequence cautioni

The sequence AAC50906 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti259A → T in BAC04120 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0362401 – 11MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCT PHSSRSDLVLPGTAGDFSLS ASLSACTLLYE in isoform 2. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_03624112 – 109GAVEP…SLREL → PASSVSGSGGAESQDRMRDS SAPSSASSSVTDLYCTPHSS RSDLVLPGMAGDFSLSASLS ACTLLYEGAVEPMQIDVDPQ EDP in isoform 3. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_036242103 – 106Missing in isoform 2 and isoform 4. 2 Publications4
Alternative sequenceiVSP_011882471 – 491REGSQ…MSTNM → TSTDLGPPGGSVLPAAQLRG LATGCHPACVPSLGLRRQAA ASCGPSWKERPAGLDPVGFC PQGADCAAPRPSGTISQTPP VPASVRCRQVGGVH in isoform 3. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20285 mRNA Translation: AAC50906.2 Different initiation.
AK093283 mRNA Translation: BAC04120.1
AC135056 Genomic DNA No translation available.
BC000155 mRNA Translation: AAH00155.3
BC064503 mRNA Translation: AAH64503.1
BT009834 mRNA Translation: AAP88836.1
CCDSiCCDS11800.1 [Q13098-7]
CCDS32774.1 [Q13098-4]
CCDS82226.1 [Q13098-5]
PIRiG01646
RefSeqiNP_001308021.1, NM_001321092.1 [Q13098-5]
NP_004118.3, NM_004127.5 [Q13098-4]
NP_997657.1, NM_212492.2 [Q13098-7]
XP_016880023.1, XM_017024534.1
UniGeneiHs.268530

Genome annotation databases

EnsembliENST00000306823; ENSP00000302873; ENSG00000169727 [Q13098-4]
ENST00000392358; ENSP00000376167; ENSG00000169727 [Q13098-7]
ENST00000578552; ENSP00000462265; ENSG00000169727 [Q13098-5]
GeneIDi2873
KEGGihsa:2873
UCSCiuc002kdk.2 human [Q13098-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCSN1_HUMAN
AccessioniPrimary (citable) accession number: Q13098
Secondary accession number(s): Q8NA10, Q9BWL1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 10, 2009
Last modified: July 18, 2018
This is version 176 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health