UniProtKB - Q13015 (AF1Q_HUMAN)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q13015|AF1Q_HUMAN Protein AF1q OS=Homo sapiens OX=9606 GN=MLLT11 PE=1 SV=1 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN PEGDGLLEYSTFNFWRAPIASIHSFELDLL
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Protein
Protein AF1q
Gene
MLLT11
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Cofactor for the transcription factor TCF7 (PubMed:26079538). Involved in regulation of lymphoid development by driving multipotent hematopoietic progenitor cells towards a T cell fate (PubMed:21715312).2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway."
Parcelier A., Maharzi N., Delord M., Robledo-Sarmiento M., Nelson E., Belakhdar-Mekid H., Pla M., Kuranda K., Parietti V., Goodhardt M., Legrand N., Bernstein I.D., Gluckman J.C., Sigaux F., Canque B.
Blood 118:1784-1796(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 24-LEU--LEU-32, UBIQUITINATION, NUCLEAR EXPORT SIGNAL. - Ref.9"AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis."
Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting S.T., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson L.F., Rojanasakul Y. , Remick S., Ivanov A., Pugacheva E., Bunting K.D., Moriggl R., Kenner L., Tse W.
Oncotarget 6:20697-20710(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH TCF7, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- extrinsic apoptotic signaling pathway Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- intrinsic apoptotic signaling pathway Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of apoptotic process Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of mitochondrial depolarization Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of release of cytochrome c from mitochondria Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of transcription, DNA-templated Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Protein AF1q |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:MLLT11 Synonyms:AF1Q |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000213190.3 |
Human Gene Nomenclature Database More...HGNCi | HGNC:16997 MLLT11 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 604684 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q13015 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Cytoskeleton
- centrosome 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway."
Parcelier A., Maharzi N., Delord M., Robledo-Sarmiento M., Nelson E., Belakhdar-Mekid H., Pla M., Kuranda K., Parietti V., Goodhardt M., Legrand N., Bernstein I.D., Gluckman J.C., Sigaux F., Canque B.
Blood 118:1784-1796(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 24-LEU--LEU-32, UBIQUITINATION, NUCLEAR EXPORT SIGNAL.
- centrosome 1 Publication
Nucleus
- Nucleus 2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway."
Parcelier A., Maharzi N., Delord M., Robledo-Sarmiento M., Nelson E., Belakhdar-Mekid H., Pla M., Kuranda K., Parietti V., Goodhardt M., Legrand N., Bernstein I.D., Gluckman J.C., Sigaux F., Canque B.
Blood 118:1784-1796(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 24-LEU--LEU-32, UBIQUITINATION, NUCLEAR EXPORT SIGNAL. - Ref.9"AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis."
Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting S.T., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson L.F., Rojanasakul Y. , Remick S., Ivanov A., Pugacheva E., Bunting K.D., Moriggl R., Kenner L., Tse W.
Oncotarget 6:20697-20710(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH TCF7, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
- Nucleus 2 Publications
Other locations
- Cytoplasm 2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway."
Parcelier A., Maharzi N., Delord M., Robledo-Sarmiento M., Nelson E., Belakhdar-Mekid H., Pla M., Kuranda K., Parietti V., Goodhardt M., Legrand N., Bernstein I.D., Gluckman J.C., Sigaux F., Canque B.
Blood 118:1784-1796(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 24-LEU--LEU-32, UBIQUITINATION, NUCLEAR EXPORT SIGNAL. - Ref.9"AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis."
Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting S.T., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson L.F., Rojanasakul Y. , Remick S., Ivanov A., Pugacheva E., Bunting K.D., Moriggl R., Kenner L., Tse W.
Oncotarget 6:20697-20710(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH TCF7, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Note: Continuous nuclear export is followed by degradation.1 Publication- Cytoplasm 2 Publications
- Ref.7"AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway."
Parcelier A., Maharzi N., Delord M., Robledo-Sarmiento M., Nelson E., Belakhdar-Mekid H., Pla M., Kuranda K., Parietti V., Goodhardt M., Legrand N., Bernstein I.D., Gluckman J.C., Sigaux F., Canque B.
Blood 118:1784-1796(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 24-LEU--LEU-32, UBIQUITINATION, NUCLEAR EXPORT SIGNAL.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
Cytoskeleton
- microtubule organizing center Source: UniProtKB-SubCell
Cytosol
- cytosol Source: HPA
Nucleus
- nucleoplasm Source: HPA
Other locations
- intracellular Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Cytoplasm, Cytoskeleton, Nucleus<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei
A chromosomal aberration involving MLLT11 is found in acute leukemias. Translocation t(1;11)(q21;q23) with KMT2A/MLL1.
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 24 – 32 | LSELEGLGL → ASEAEGAGA: Constitutive nuclear sequestration. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 9 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Diseasei
Proto-oncogeneOrganism-specific databases
DisGeNET More...DisGeNETi | 10962 |
MalaCards human disease database More...MalaCardsi | MLLT11 |
Open Targets More...OpenTargetsi | ENSG00000213190 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA142671347 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | MLLT11 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000064471 | 1 – 90 | Protein AF1qAdd BLAST | 90 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 84 | PhosphoserineBy similarity <p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi | 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
Ubiquitinated, leading to degradation.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway."
Parcelier A., Maharzi N., Delord M., Robledo-Sarmiento M., Nelson E., Belakhdar-Mekid H., Pla M., Kuranda K., Parietti V., Goodhardt M., Legrand N., Bernstein I.D., Gluckman J.C., Sigaux F., Canque B.
Blood 118:1784-1796(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 24-LEU--LEU-32, UBIQUITINATION, NUCLEAR EXPORT SIGNAL.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Phosphoprotein, Ubl conjugationProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | Q13015 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q13015 |
PeptideAtlas More...PeptideAtlasi | Q13015 |
PRoteomics IDEntifications database More...PRIDEi | Q13015 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 59101 |
Consortium for Top Down Proteomics More...TopDownProteomicsi | Q13015 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q13015 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q13015 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Expressed in myoepithelial cells of normal breast tissue (at protein level) (PubMed:26079538). Highly expressed in thymus (PubMed:7833468). Expressed in colon, small intestine, prostate and ovary. Not detected in peripheral blood lymphocytes and spleen (PubMed:7833468).2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"A novel gene, AF1q, fused to MLL in t(1;11)(q21;q23), is specifically expressed in leukemic and immature hematopoietic cells."
Tse W., Zhu W., Chen H.S., Cohen A.
Blood 85:650-656(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHROMOSOMAL REARRANGEMENT, TISSUE SPECIFICITY. - Ref.9"AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis."
Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting S.T., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson L.F., Rojanasakul Y. , Remick S., Ivanov A., Pugacheva E., Bunting K.D., Moriggl R., Kenner L., Tse W.
Oncotarget 6:20697-20710(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH TCF7, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000213190 |
CleanEx database of gene expression profiles More...CleanExi | HS_MLLT11 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q13015 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q13015 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | HPA000540 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Interacts with HSPA8 and LAMP2 isoform A; the interaction may target MLLT11 for degradation via chaperone-mediated autophagy (PubMed:24880125). Interacts with TCF7 (PubMed:26079538).2 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Degradation of AF1Q by chaperone-mediated autophagy."
Li P., Ji M., Lu F., Zhang J., Li H., Cui T., Li Wang X., Tang D., Ji C.
Exp. Cell Res. 327:48-56(2014) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH HSPA8 AND LAMP2. - Ref.9"AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis."
Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting S.T., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson L.F., Rojanasakul Y. , Remick S., Ivanov A., Pugacheva E., Bunting K.D., Moriggl R., Kenner L., Tse W.
Oncotarget 6:20697-20710(2015) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH TCF7, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TCF7 | P36402 | 2 | EBI-6269719,EBI-2119465 |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 116161, 6 interactors |
Protein interaction database and analysis system More...IntActi | Q13015, 7 interactors |
Molecular INTeraction database More...MINTi | Q13015 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000357917 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q13015 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi | 24 – 32 | Nuclear export signal1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 9 |
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the MLLT11 family.Curated
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IZF7 Eukaryota ENOG4112CHF LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000009895 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000033833 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q13015 |
Identification of Orthologs from Complete Genome Data More...OMAi | KMTGQAT |
Database of Orthologous Groups More...OrthoDBi | EOG091G10XZ |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q13015 |
TreeFam database of animal gene trees More...TreeFami | TF336906 |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR026778 MLLT11_fam IPR033461 WRNPLPNID |
The PANTHER Classification System More...PANTHERi | PTHR15404 PTHR15404, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF15017 WRNPLPNID, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
Q13015-1 [UniParc]FASTAAdd to basketAdded to basketShow »
10 20 30 40 50
MRDPVSSQYS SFLFWRMPIP ELDLSELEGL GLSDTATYKV KDSSVGKMIG
60 70 80 90
QATAADQEKN PEGDGLLEYS TFNFWRAPIA SIHSFELDLL
Length:90
Mass (Da):10,061
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iB37C6F7303C9EBF8
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | U16954 mRNA Translation: AAA70088.1 BT006799 mRNA Translation: AAP35445.1 CR456879 mRNA Translation: CAG33160.1 AL590133 Genomic DNA No translation available. BC006471 mRNA No translation available. BC008445 mRNA Translation: AAH08445.1 BC009624 mRNA Translation: AAH09624.1 BC019253 mRNA Translation: AAH19253.1 BC021703 mRNA Translation: AAH21703.1 BC022448 mRNA Translation: AAH22448.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS982.1 |
Protein sequence database of the Protein Information Resource More...PIRi | I38889 |
NCBI Reference Sequences More...RefSeqi | NP_006809.1, NM_006818.3 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.75823 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000368921; ENSP00000357917; ENSG00000213190 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 10962 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:10962 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Chromosomal rearrangement<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q13015 | AF1Q protein (Fragment) | 90 | |||
| MLLT11 isoform 1 | 90 | ||||
| MLLT11, transcription factor 7 cofactor | 90 |
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q13015 | AF1Q protein (Fragment) | 90 | |||
| MLLT11 isoform 1 | 90 | ||||
| MLLT11, transcription factor 7 cofactor | 90 | ||||
| MLLT11, transcription factor 7 cofactor | 90 | ||||
| UPI0002744E4C | 90 | ||||
| +1 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q13015 | AF1Q protein (Fragment) | 90 | |||
| MLLT11 isoform 1 | 90 | ||||
| MLLT11, transcription factor 7 cofactor | 90 | ||||
| MLLT11, transcription factor 7 cofactor | 90 | ||||
| UPI0005F484A4 | 90 | ||||
| +55 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | U16954 mRNA Translation: AAA70088.1 BT006799 mRNA Translation: AAP35445.1 CR456879 mRNA Translation: CAG33160.1 AL590133 Genomic DNA No translation available. BC006471 mRNA No translation available. BC008445 mRNA Translation: AAH08445.1 BC009624 mRNA Translation: AAH09624.1 BC019253 mRNA Translation: AAH19253.1 BC021703 mRNA Translation: AAH21703.1 BC022448 mRNA Translation: AAH22448.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS982.1 |
Protein sequence database of the Protein Information Resource More...PIRi | I38889 |
NCBI Reference Sequences More...RefSeqi | NP_006809.1, NM_006818.3 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.75823 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q13015 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 116161, 6 interactors |
Protein interaction database and analysis system More...IntActi | Q13015, 7 interactors |
Molecular INTeraction database More...MINTi | Q13015 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000357917 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q13015 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q13015 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | MLLT11 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | Q13015 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q13015 |
PeptideAtlas More...PeptideAtlasi | Q13015 |
PRoteomics IDEntifications database More...PRIDEi | Q13015 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 59101 |
Consortium for Top Down Proteomics More...TopDownProteomicsi | Q13015 |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 10962 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000368921; ENSP00000357917; ENSG00000213190 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 10962 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:10962 |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 10962 |
DisGeNET More...DisGeNETi | 10962 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000213190.3 |
GeneCards: human genes, protein and diseases More...GeneCardsi | MLLT11 |
Human Gene Nomenclature Database More...HGNCi | HGNC:16997 MLLT11 |
Human Protein Atlas More...HPAi | HPA000540 |
MalaCards human disease database More...MalaCardsi | MLLT11 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 604684 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q13015 |
Open Targets More...OpenTargetsi | ENSG00000213190 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA142671347 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IZF7 Eukaryota ENOG4112CHF LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000009895 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000033833 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q13015 |
Identification of Orthologs from Complete Genome Data More...OMAi | KMTGQAT |
Database of Orthologous Groups More...OrthoDBi | EOG091G10XZ |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q13015 |
TreeFam database of animal gene trees More...TreeFami | TF336906 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | MLLT11 human |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 10962 |
Protein Ontology More...PROi | PR:Q13015 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000213190 |
CleanEx database of gene expression profiles More...CleanExi | HS_MLLT11 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q13015 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q13015 HS |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR026778 MLLT11_fam IPR033461 WRNPLPNID |
The PANTHER Classification System More...PANTHERi | PTHR15404 PTHR15404, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF15017 WRNPLPNID, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | AF1Q_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q13015Primary (citable) accession number: Q13015 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | May 30, 2000 |
| Last sequence update: | November 1, 1996 | |
| Last modified: | June 20, 2018 | |
| This is version 131 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families
