Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2

Gene

BNIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins.

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • GTPase activator activity Source: ProtInc
  • identical protein binding Source: GO_Central

GO - Biological processi

  • apoptotic process Source: MGI
  • negative regulation of apoptotic process Source: UniProtKB
  • positive regulation of muscle cell differentiation Source: Reactome

Keywordsi

Biological processApoptosis

Enzyme and pathway databases

ReactomeiR-HSA-375170 CDO in myogenesis
SIGNORiQ12982

Chemistry databases

SwissLipidsiSLP:000001512

Names & Taxonomyi

Protein namesi
Recommended name:
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Gene namesi
Name:BNIP2
Synonyms:NIP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000140299.11
HGNCiHGNC:1083 BNIP2
MIMi603292 gene
neXtProtiNX_Q12982

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi663
OpenTargetsiENSG00000140299
PharmGKBiPA25393

Polymorphism and mutation databases

BioMutaiBNIP2
DMDMi6093506

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000649611 – 314BCL2/adenovirus E1B 19 kDa protein-interacting protein 2Add BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei41PhosphoserineCombined sources1
Modified residuei77PhosphoserineCombined sources1
Modified residuei87PhosphothreonineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei92PhosphoserineCombined sources1
Modified residuei114PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ12982
MaxQBiQ12982
PaxDbiQ12982
PeptideAtlasiQ12982
PRIDEiQ12982
ProteomicsDBi59079
59080 [Q12982-2]

PTM databases

iPTMnetiQ12982
PhosphoSitePlusiQ12982

Expressioni

Gene expression databases

BgeeiENSG00000140299
CleanExiHS_BNIP2
ExpressionAtlasiQ12982 baseline and differential
GenevisibleiQ12982 HS

Organism-specific databases

HPAiHPA026843

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107131, 18 interactors
CORUMiQ12982
ELMiQ12982
IntActiQ12982, 50 interactors
MINTiQ12982
STRINGi9606.ENSP00000267859

Structurei

3D structure databases

ProteinModelPortaliQ12982
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini147 – 304CRAL-TRIOPROSITE-ProRule annotationAdd BLAST158

Phylogenomic databases

eggNOGiENOG410IFPU Eukaryota
ENOG410YCZE LUCA
GeneTreeiENSGT00420000029688
HOGENOMiHOG000230952
HOVERGENiHBG054692
InParanoidiQ12982
KOiK18448
OMAiLNGKQEQ
PhylomeDBiQ12982

Family and domain databases

CDDicd00170 SEC14, 1 hit
Gene3Di3.40.525.10, 1 hit
InterProiView protein in InterPro
IPR022181 Bcl2-/adenovirus-E1B
IPR001251 CRAL-TRIO_dom
IPR036865 CRAL-TRIO_dom_sf
PfamiView protein in Pfam
PF12496 BNIP2, 1 hit
PF13716 CRAL_TRIO_2, 1 hit
SMARTiView protein in SMART
SM00516 SEC14, 1 hit
SUPFAMiSSF52087 SSF52087, 1 hit
PROSITEiView protein in PROSITE
PS50191 CRAL_TRIO, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12982-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGVELKEEW QDEDFPIPLP EDDSIEADIL AITGPEDQPG SLEVNGNKVR
60 70 80 90 100
KKLMAPDISL TLDPSDGSVL SDDLDESGEI DLDGLDTPSE NSNEFEWEDD
110 120 130 140 150
LPKPKTTEVI RKGSITEYTA AEEKEDGRRW RMFRIGEQDH RVDMKAIEPY
160 170 180 190 200
KKVISHGGYY GDGLNAIVVF AVCFMPESSQ PNYRYLMDNL FKYVIGTLEL
210 220 230 240 250
LVAENYMIVY LNGATTRRKM PSLGWLRKCY QQIDRRLRKN LKSLIIVHPS
260 270 280 290 300
WFIRTLLAVT RPFISSKFSQ KIRYVFNLAE LAELVPMEYV GIPECIKQVD
310
QELNGKQDEP KNEQ
Length:314
Mass (Da):36,018
Last modified:November 1, 1996 - v1
Checksum:i0A3CEC636569DD2F
GO
Isoform 2 (identifier: Q12982-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPCPSSAPPPFYPGVGEVAGLRWFSIYDQRPSWYRTKKLGLLDIGSLDYQEFVVDIESRLRM

Show »
Length:376
Mass (Da):43,135
Checksum:i993DE21B8DF0D556
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti175M → T in BAG61556 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01883724S → T1 PublicationCorresponds to variant dbSNP:rs6151509Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0389641M → MEPCPSSAPPPFYPGVGEVA GLRWFSIYDQRPSWYRTKKL GLLDIGSLDYQEFVVDIESR LRM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15173 mRNA Translation: AAC00021.1
AK299628 mRNA Translation: BAG61556.1
AY268590 Genomic DNA Translation: AAP03429.1
AC092755 Genomic DNA No translation available.
BC002461 mRNA Translation: AAH02461.1
CCDSiCCDS81889.1 [Q12982-2]
PIRiI38864
RefSeqiNP_001307604.1, NM_001320675.1 [Q12982-2]
NP_004321.2, NM_004330.3
UniGeneiHs.592515
Hs.646490

Genome annotation databases

EnsembliENST00000415213; ENSP00000412767; ENSG00000140299 [Q12982-2]
ENST00000607373; ENSP00000475320; ENSG00000140299 [Q12982-1]
GeneIDi663
KEGGihsa:663
UCSCiuc010uhb.3 human [Q12982-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBNIP2_HUMAN
AccessioniPrimary (citable) accession number: Q12982
Secondary accession number(s): B4DS94
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1996
Last modified: July 18, 2018
This is version 154 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health