Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vesicle transport protein SEC20

Gene

BNIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization (PubMed:15272311). Plays also a role in apoptosis (PubMed:7954800, PubMed:15272311, PubMed:23896122). It is for instance required for endoplasmic reticulum stress-induced apoptosis (PubMed:23896122). As a substrate of RNF185 interacting with SQSTM1, might also be involved in mitochondrial autophagy (Probable).1 Publication3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • SNAP receptor activity Source: FlyBase

GO - Biological processi

  • apoptotic process Source: MGI
  • endoplasmic reticulum membrane fusion Source: HGNC
  • endoplasmic reticulum organization Source: HGNC
  • execution phase of apoptosis Source: BHF-UCL
  • negative regulation of apoptotic process Source: UniProtKB
  • retrograde vesicle-mediated transport, Golgi to ER Source: Reactome

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, ER-Golgi transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vesicle transport protein SEC20
Alternative name(s):
BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
Transformation-related gene 8 protein
Short name:
TRG-8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BNIP1
Synonyms:NIP1, SEC20L
ORF Names:TRG8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000113734.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1082 BNIP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603291 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12981

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 199CytoplasmicSequence analysisAdd BLAST199
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei200 – 220Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini221 – 228LumenalSequence analysis8

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi114L → A: Loss of proapoptotic effect. No effect on interaction with RINT1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
662

Open Targets

More...
OpenTargetsi
ENSG00000113734

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25392

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BNIP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
93141310

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000649601 – 228Vesicle transport protein SEC20Add BLAST228

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Polyubiquitinated (PubMed:21931693, PubMed:23896122). 'Lys-63'-linked polyubiquitination by RNF185 increases the interaction with the autophagy receptor SQSTM1 (PubMed:21931693). Undergoes 'Lys-29'- and 'Lys-63'-linked polyubiquitination by RNF186 that may regulate BNIP1 localization to the mitochondrion (PubMed:23896122).2 Publications

Keywords - PTMi

Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q12981

PeptideAtlas

More...
PeptideAtlasi
Q12981

PRoteomics IDEntifications database

More...
PRIDEi
Q12981

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59075
59076 [Q12981-1]
59077 [Q12981-2]
59078 [Q12981-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12981

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12981

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000113734 Expressed in 178 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_BNIP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12981 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12981 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008009
HPA008149

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B (PubMed:15272311). Interacts directly with STX18, RINT1/TIP20L and NAPA (PubMed:15272311). Interacts with ZW10 through RINT1 (PubMed:15272311). Interacts with BCL2 (PubMed:7954800). Interacts with RNF186 (PubMed:23896122). Interacts with RNF185 (PubMed:21931693). Interacts with SQSTM1; increased by 'Lys-63'-linked polyubiquitination of BNIP1 (PubMed:21931693).4 Publications
(Microbial infection) Interacts with adenovirus E1B 19K protein; plays a role in the suppression of cell apoptosis by the viral protein.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107130, 56 interactors

Protein interaction database and analysis system

More...
IntActi
Q12981, 16 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q12981

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili37 – 90Sequence analysisAdd BLAST54

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SEC20 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014412

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050708

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12981

KEGG Orthology (KO)

More...
KOi
K08497

Identification of Orthologs from Complete Genome Data

More...
OMAi
CVFYIVQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0T5O

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12981

TreeFam database of animal gene trees

More...
TreeFami
TF324339

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005606 Sec20

The PANTHER Classification System

More...
PANTHERi
PTHR12825 PTHR12825, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03908 Sec20, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12981-4) [UniParc]FASTAAdd to basket
Also known as: BNIP1, S4

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPQDVHVR ICNQEIVKFD LEVKALIQDI RDCSGPLSAL TELNTKVKEK
60 70 80 90 100
FQQLRHRIQD LEQLAKEQDK ESEKQLLLQE VENHKKQMLS NQASWRKANL
110 120 130 140 150
TCKIAIDNLE KAELLQGGDL LRQRKTTKES LAQTSSTITE SLMGISRMMA
160 170 180 190 200
QQVQQSEEAM QSLVTSSRTI LDANEEFKSM SGTIQLGRKL ITKYNRRELT
210 220
DKLLIFLALA LFLATVLYIV KKRLFPFL
Length:228
Mass (Da):26,132
Last modified:April 18, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i23F4C21E7327DE3D
GO
Isoform 2 (identifier: Q12981-2) [UniParc]FASTAAdd to basket
Also known as: BNIP1-a, S1

The sequence of this isoform differs from the canonical sequence as follows:
     90-123: Missing.

Show »
Length:194
Mass (Da):22,352
Checksum:iE1AAA43E09F6F7F4
GO
Isoform 3 (identifier: Q12981-1) [UniParc]FASTAAdd to basket
Also known as: BNIP1-b, S2

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS

Show »
Length:271
Mass (Da):31,113
Checksum:i2E5226F028FF2D1A
GO
Isoform 4 (identifier: Q12981-3) [UniParc]FASTAAdd to basket
Also known as: BNIP1-c, S3

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS
     90-123: Missing.

Show »
Length:237
Mass (Da):27,333
Checksum:iFDE67A8CE1CE1AAB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YBK7H0YBK7_HUMAN
Vesicle transport protein SEC20
BNIP1
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14Q → R in AAO91805 (Ref. 3) Curated1
Sequence conflicti66K → E in AAO91805 (Ref. 3) Curated1
Sequence conflicti210A → R (PubMed:7954800).Curated1
Sequence conflicti210A → R (PubMed:10217402).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01916914Q → H1 PublicationCorresponds to variant dbSNP:rs5745100Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01790159Q → QPVLYQRAFIWTASTFFFKL TYSLTDFSSTQHDFNSPTTP VTFS in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_00433090 – 123Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U15172 mRNA Translation: AAC00020.1
AF083956 mRNA Translation: AAC33124.1
AF083957 mRNA Translation: AAC33125.1
AF083958 mRNA Translation: AAC33126.1
AY216799 mRNA Translation: AAO91805.1
AY246554 Genomic DNA Translation: AAO61090.1
CH471062 Genomic DNA Translation: EAW61405.1
CH471062 Genomic DNA Translation: EAW61406.1
CH471062 Genomic DNA Translation: EAW61408.1
CH471062 Genomic DNA Translation: EAW61409.1
CH471062 Genomic DNA Translation: EAW61410.1
CH471062 Genomic DNA Translation: EAW61411.1
CH471062 Genomic DNA Translation: EAW61412.1
CH471062 Genomic DNA Translation: EAW61413.1
BC010959 mRNA Translation: AAH10959.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43400.1 [Q12981-2]
CCDS4384.1 [Q12981-4]
CCDS4385.1 [Q12981-1]
CCDS4386.1 [Q12981-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
I38863

NCBI Reference Sequences

More...
RefSeqi
NP_001196.2, NM_001205.2 [Q12981-4]
NP_053581.2, NM_013978.2 [Q12981-2]
NP_053582.2, NM_013979.2 [Q12981-1]
NP_053583.2, NM_013980.2 [Q12981-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.145726

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000231668; ENSP00000231668; ENSG00000113734 [Q12981-1]
ENST00000351486; ENSP00000239215; ENSG00000113734 [Q12981-4]
ENST00000352523; ENSP00000239214; ENSG00000113734 [Q12981-3]
ENST00000393770; ENSP00000377365; ENSG00000113734 [Q12981-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
662

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:662

UCSC genome browser

More...
UCSCi
uc003mci.5 human [Q12981-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15172 mRNA Translation: AAC00020.1
AF083956 mRNA Translation: AAC33124.1
AF083957 mRNA Translation: AAC33125.1
AF083958 mRNA Translation: AAC33126.1
AY216799 mRNA Translation: AAO91805.1
AY246554 Genomic DNA Translation: AAO61090.1
CH471062 Genomic DNA Translation: EAW61405.1
CH471062 Genomic DNA Translation: EAW61406.1
CH471062 Genomic DNA Translation: EAW61408.1
CH471062 Genomic DNA Translation: EAW61409.1
CH471062 Genomic DNA Translation: EAW61410.1
CH471062 Genomic DNA Translation: EAW61411.1
CH471062 Genomic DNA Translation: EAW61412.1
CH471062 Genomic DNA Translation: EAW61413.1
BC010959 mRNA Translation: AAH10959.1
CCDSiCCDS43400.1 [Q12981-2]
CCDS4384.1 [Q12981-4]
CCDS4385.1 [Q12981-1]
CCDS4386.1 [Q12981-3]
PIRiI38863
RefSeqiNP_001196.2, NM_001205.2 [Q12981-4]
NP_053581.2, NM_013978.2 [Q12981-2]
NP_053582.2, NM_013979.2 [Q12981-1]
NP_053583.2, NM_013980.2 [Q12981-3]
UniGeneiHs.145726

3D structure databases

ProteinModelPortaliQ12981
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107130, 56 interactors
IntActiQ12981, 16 interactors

PTM databases

iPTMnetiQ12981
PhosphoSitePlusiQ12981

Polymorphism and mutation databases

BioMutaiBNIP1
DMDMi93141310

Proteomic databases

EPDiQ12981
PeptideAtlasiQ12981
PRIDEiQ12981
ProteomicsDBi59075
59076 [Q12981-1]
59077 [Q12981-2]
59078 [Q12981-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
662
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000231668; ENSP00000231668; ENSG00000113734 [Q12981-1]
ENST00000351486; ENSP00000239215; ENSG00000113734 [Q12981-4]
ENST00000352523; ENSP00000239214; ENSG00000113734 [Q12981-3]
ENST00000393770; ENSP00000377365; ENSG00000113734 [Q12981-2]
GeneIDi662
KEGGihsa:662
UCSCiuc003mci.5 human [Q12981-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
662
DisGeNETi662
EuPathDBiHostDB:ENSG00000113734.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BNIP1
HGNCiHGNC:1082 BNIP1
HPAiHPA008009
HPA008149
MIMi603291 gene
neXtProtiNX_Q12981
OpenTargetsiENSG00000113734
PharmGKBiPA25392

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000014412
HOVERGENiHBG050708
InParanoidiQ12981
KOiK08497
OMAiCVFYIVQ
OrthoDBiEOG091G0T5O
PhylomeDBiQ12981
TreeFamiTF324339

Enzyme and pathway databases

ReactomeiR-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BNIP1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
662

Protein Ontology

More...
PROi
PR:Q12981

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000113734 Expressed in 178 organ(s), highest expression level in secondary oocyte
CleanExiHS_BNIP1
ExpressionAtlasiQ12981 baseline and differential
GenevisibleiQ12981 HS

Family and domain databases

InterProiView protein in InterPro
IPR005606 Sec20
PANTHERiPTHR12825 PTHR12825, 1 hit
PfamiView protein in Pfam
PF03908 Sec20, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEC20_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12981
Secondary accession number(s): D3DQM3
, D3DQM4, D3DQM5, D3DQM6, O75622, O75623, O75624, Q6K044, Q96FG4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 18, 2006
Last modified: November 7, 2018
This is version 154 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again