Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor of activated T-cells, cytoplasmic 3

Gene

NFATC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a regulator of transcriptional activation. Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi444 – 4518

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2025928 Calcineurin activates NFAT
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-5607763 CLEC7A (Dectin-1) induces NFAT activation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q12968

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 3
Short name:
NF-ATc3
Short name:
NFATc3
Alternative name(s):
NFATx
T-cell transcription factor NFAT4
Short name:
NF-AT4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NFATC3
Synonyms:NFAT4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000072736.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7777 NFATC3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602698 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12968

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4775

Open Targets

More...
OpenTargetsi
ENSG00000072736

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA247

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NFATC3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
9087155

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002051802 – 1075Nuclear factor of activated T-cells, cytoplasmic 3Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonine1 Publication1
Modified residuei344PhosphoserineBy similarity1
Modified residuei372PhosphoserineCombined sources1
Modified residuei1063PhosphoserineCombined sources1
Modified residuei1066PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q12968

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q12968

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q12968

PeptideAtlas

More...
PeptideAtlasi
Q12968

PRoteomics IDEntifications database

More...
PRIDEi
Q12968

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59061
59062 [Q12968-2]
59063 [Q12968-3]
59064 [Q12968-4]
59065 [Q12968-5]
59066 [Q12968-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12968

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12968

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000072736 Expressed in 214 organ(s), highest expression level in leukocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_NFATC3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12968 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12968 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA050665

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
RAF1P040492EBI-5278441,EBI-365996

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110848, 15 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q12968

Protein interaction database and analysis system

More...
IntActi
Q12968, 5 interactors

Molecular INTeraction database

More...
MINTi
Q12968

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000300659

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11075
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q12968

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q12968

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati207 – 2231Add BLAST17
Repeati236 – 2522Add BLAST17
Repeati292 – 3083Add BLAST17
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini415 – 596RHDPROSITE-ProRule annotationAdd BLAST182

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni109 – 114Calcineurin-binding6
Regioni207 – 3083 X SP repeatsAdd BLAST102

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi273 – 275Nuclear localization signal3
Motifi686 – 688Nuclear localization signal3
Motifi1032 – 1041Nuclear export signal10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi24 – 29Poly-Pro6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIAD Eukaryota
ENOG4111EMW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156131

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231780

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG069754

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12968

KEGG Orthology (KO)

More...
KOi
K17333

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHQEIDA

Database of Orthologous Groups

More...
OrthoDBi
EOG091G01QP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12968

TreeFam database of animal gene trees

More...
TreeFami
TF326480

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit
2.60.40.340, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR008366 NFAT
IPR008967 p53-like_TF_DNA-bd
IPR032397 RHD_dimer
IPR011539 RHD_DNA_bind_dom
IPR037059 RHD_DNA_bind_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12533 PTHR12533, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16179 RHD_dimer, 1 hit
PF00554 RHD_DNA_bind, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01789 NUCFACTORATC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429 IPT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49417 SSF49417, 1 hit
SSF81296 SSF81296, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50254 REL_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12968-1) [UniParc]FASTAAdd to basket
Also known as: X1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTANCGAHD ELDFKLVFGE DGAPAPPPPG SRPADLEPDD CASIYIFNVD
60 70 80 90 100
PPPSTLTTPL CLPHHGLPSH SSVLSPSFQL QSHKNYEGTC EIPESKYSPL
110 120 130 140 150
GGPKPFECPS IQITSISPNC HQELDAHEDD LQINDPEREF LERPSRDHLY
160 170 180 190 200
LPLEPSYRES SLSPSPASSI SSRSWFSDAS SCESLSHIYD DVDSELNEAA
210 220 230 240 250
ARFTLGSPLT SPGGSPGGCP GEETWHQQYG LGHSLSPRQS PCHSPRSSVT
260 270 280 290 300
DENWLSPRPA SGPSSRPTSP CGKRRHSSAE VCYAGSLSPH HSPVPSPGHS
310 320 330 340 350
PRGSVTEDTW LNASVHGGSG LGPAVFPFQY CVETDIPLKT RKTSEDQAAI
360 370 380 390 400
LPGKLELCSD DQGSLSPARE TSIDDGLGSQ YPLKKDSCGD QFLSVPSPFT
410 420 430 440 450
WSKPKPGHTP IFRTSSLPPL DWPLPAHFGQ CELKIEVQPK THHRAHYETE
460 470 480 490 500
GSRGAVKAST GGHPVVKLLG YNEKPINLQM FIGTADDRYL RPHAFYQVHR
510 520 530 540 550
ITGKTVATAS QEIIIASTKV LEIPLLPENN MSASIDCAGI LKLRNSDIEL
560 570 580 590 600
RKGETDIGRK NTRVRLVFRV HIPQPSGKVL SLQIASIPVE CSQRSAQELP
610 620 630 640 650
HIEKYSINSC SVNGGHEMVV TGSNFLPESK IIFLEKGQDG RPQWEVEGKI
660 670 680 690 700
IREKCQGAHI VLEVPPYHNP AVTAAVQVHF YLCNGKRKKS QSQRFTYTPV
710 720 730 740 750
LMKQEHREEI DLSSVPSLPV PHPAQTQRPS SDSGCSHDSV LSGQRSLICS
760 770 780 790 800
IPQTYASMVT SSHLPQLQCR DESVSKEQHM IPSPIVHQPF QVTPTPPVGS
810 820 830 840 850
SYQPMQTNVV YNGPTCLPIN AASSQEFDSV LFQQDATLSG LVNLGCQPLS
860 870 880 890 900
SIPFHSSNSG STGHLLAHTP HSVHTLPHLQ SMGYHCSNTG QRSLSSPVAD
910 920 930 940 950
QITGQPSSQL QPITYGPSHS GSATTASPAA SHPLASSPLS GPPSPQLQPM
960 970 980 990 1000
PYQSPSSGTA SSPSPATRMH SGQHSTQAQS TGQGGLSAPS SLICHSLCDP
1010 1020 1030 1040 1050
ASFPPDGATV SIKPEPEDRE PNFATIGLQD ITLDDVNEII GRDMSQISVS
1060 1070
QGAGVSRQAP LPSPESLDLG RSDGL
Length:1,075
Mass (Da):115,594
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0B25D61A2B56D898
GO
Isoform 2 (identifier: Q12968-2) [UniParc]FASTAAdd to basket
Also known as: X2, C

The sequence of this isoform differs from the canonical sequence as follows:
     1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → DQFISDLEHQPSGSAEKWPNHSVLSCPAPFWRI

Show »
Length:1,068
Mass (Da):115,237
Checksum:iCD91817D06AD5D82
GO
Isoform 3 (identifier: Q12968-3) [UniParc]FASTAAdd to basket
Also known as: X3

The sequence of this isoform differs from the canonical sequence as follows:
     1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → DLFTSNNFDLLQLRPTFWPVPAGRYLRNLE

Show »
Length:1,065
Mass (Da):115,050
Checksum:iB827F1D5CE01D033
GO
Isoform 4 (identifier: Q12968-4) [UniParc]FASTAAdd to basket
Also known as: X4

The sequence of this isoform differs from the canonical sequence as follows:
     1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → GKFISDMFLK

Show »
Length:1,045
Mass (Da):112,642
Checksum:i44CE97FCF4A4EEAD
GO
Isoform 5 (identifier: Q12968-5) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     700-1075: VLMKQEHREE...SLDLGRSDGL → GTRSHDGLL

Show »
Length:708
Mass (Da):77,181
Checksum:iD96C59AEC592D0E0
GO
Isoform 6 (identifier: Q12968-6) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     717-1075: SLPVPHPAQT...SLDLGRSDGL → TLPQTSRQTLLGSQPPSASPPTV

Show »
Length:739
Mass (Da):80,582
Checksum:i8AB8BAFA1A319E50
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L3K7I3L3K7_HUMAN
Nuclear factor of-activated T-cells...
NFATC3
1,047Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRS1H3BRS1_HUMAN
Nuclear factor of-activated T-cells...
NFATC3
1,060Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BR83H3BR83_HUMAN
Nuclear factor of-activated T-cells...
NFATC3
1,053Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU30H3BU30_HUMAN
Nuclear factor of-activated T-cells...
NFATC3
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRM3H3BRM3_HUMAN
Nuclear factor of-activated T-cells...
NFATC3
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VPH9F8VPH9_HUMAN
Nuclear factor of-activated T-cells...
NFATC3
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti702M → L in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti702M → L in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti702M → L in AAB46597 (PubMed:9759864).Curated1
Sequence conflicti831L → W in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti831L → W in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti831L → W in AAB46597 (PubMed:9759864).Curated1
Sequence conflicti899A → G in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti899A → G in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti899A → G in AAB46597 (PubMed:9759864).Curated1
Sequence conflicti923A → V in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti923A → V in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti923A → V in AAB46597 (PubMed:9759864).Curated1
Sequence conflicti935A → G in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti935A → G in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti935A → G in AAB46597 (PubMed:9759864).Curated1
Sequence conflicti947L → F in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti947L → F in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti947L → F in AAB46597 (PubMed:9759864).Curated1
Sequence conflicti960A → G in AAB46595 (PubMed:9759864).Curated1
Sequence conflicti960A → G in AAB46596 (PubMed:9759864).Curated1
Sequence conflicti960A → G in AAB46597 (PubMed:9759864).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05178475S → L. Corresponds to variant dbSNP:rs2230092Ensembl.1
Natural variantiVAR_05178594E → A. Corresponds to variant dbSNP:rs3743736Ensembl.1
Natural variantiVAR_051786100L → S. Corresponds to variant dbSNP:rs2230093Ensembl.1
Natural variantiVAR_051787136P → L. Corresponds to variant dbSNP:rs2230094Ensembl.1
Natural variantiVAR_051788382P → S. Corresponds to variant dbSNP:rs2230095Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005598700 – 1075VLMKQ…RSDGL → GTRSHDGLL in isoform 5. 1 PublicationAdd BLAST376
Alternative sequenceiVSP_005599717 – 1075SLPVP…RSDGL → TLPQTSRQTLLGSQPPSASP PTV in isoform 6. 1 PublicationAdd BLAST359
Alternative sequenceiVSP_0056001036 – 1075VNEII…RSDGL → DQFISDLEHQPSGSAEKWPN HSVLSCPAPFWRI in isoform 2. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_0056011036 – 1075VNEII…RSDGL → DLFTSNNFDLLQLRPTFWPV PAGRYLRNLE in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_0056021036 – 1075VNEII…RSDGL → GKFISDMFLK in isoform 4. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L41067 mRNA Translation: AAA79174.1
U14510 mRNA Translation: AAA86308.1
U85428 mRNA Translation: AAB46595.1
U85429 mRNA Translation: AAB46596.1
U85430 mRNA Translation: AAB46597.1
AC130462 Genomic DNA No translation available.
BC001050 mRNA Translation: AAH01050.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10860.1 [Q12968-1]
CCDS10861.1 [Q12968-3]
CCDS10862.1 [Q12968-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57377

NCBI Reference Sequences

More...
RefSeqi
NP_004546.1, NM_004555.3 [Q12968-2]
NP_775186.1, NM_173163.2 [Q12968-3]
NP_775188.1, NM_173165.2 [Q12968-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.436585

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329524; ENSP00000331324; ENSG00000072736 [Q12968-2]
ENST00000346183; ENSP00000300659; ENSG00000072736 [Q12968-1]
ENST00000349223; ENSP00000264008; ENSG00000072736 [Q12968-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4775

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4775

UCSC genome browser

More...
UCSCi
uc002evm.3 human [Q12968-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41067 mRNA Translation: AAA79174.1
U14510 mRNA Translation: AAA86308.1
U85428 mRNA Translation: AAB46595.1
U85429 mRNA Translation: AAB46596.1
U85430 mRNA Translation: AAB46597.1
AC130462 Genomic DNA No translation available.
BC001050 mRNA Translation: AAH01050.1
CCDSiCCDS10860.1 [Q12968-1]
CCDS10861.1 [Q12968-3]
CCDS10862.1 [Q12968-2]
PIRiA57377
RefSeqiNP_004546.1, NM_004555.3 [Q12968-2]
NP_775186.1, NM_173163.2 [Q12968-3]
NP_775188.1, NM_173165.2 [Q12968-1]
UniGeneiHs.436585

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2XRWX-ray1.33B141-154[»]
2XS0X-ray2.60B141-154[»]
ProteinModelPortaliQ12968
SMRiQ12968
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110848, 15 interactors
ELMiQ12968
IntActiQ12968, 5 interactors
MINTiQ12968
STRINGi9606.ENSP00000300659

PTM databases

iPTMnetiQ12968
PhosphoSitePlusiQ12968

Polymorphism and mutation databases

BioMutaiNFATC3
DMDMi9087155

Proteomic databases

EPDiQ12968
MaxQBiQ12968
PaxDbiQ12968
PeptideAtlasiQ12968
PRIDEiQ12968
ProteomicsDBi59061
59062 [Q12968-2]
59063 [Q12968-3]
59064 [Q12968-4]
59065 [Q12968-5]
59066 [Q12968-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4775
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329524; ENSP00000331324; ENSG00000072736 [Q12968-2]
ENST00000346183; ENSP00000300659; ENSG00000072736 [Q12968-1]
ENST00000349223; ENSP00000264008; ENSG00000072736 [Q12968-3]
GeneIDi4775
KEGGihsa:4775
UCSCiuc002evm.3 human [Q12968-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4775
DisGeNETi4775
EuPathDBiHostDB:ENSG00000072736.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NFATC3
HGNCiHGNC:7777 NFATC3
HPAiHPA050665
MIMi602698 gene
neXtProtiNX_Q12968
OpenTargetsiENSG00000072736
PharmGKBiPA247

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIAD Eukaryota
ENOG4111EMW LUCA
GeneTreeiENSGT00940000156131
HOGENOMiHOG000231780
HOVERGENiHBG069754
InParanoidiQ12968
KOiK17333
OMAiCHQEIDA
OrthoDBiEOG091G01QP
PhylomeDBiQ12968
TreeFamiTF326480

Enzyme and pathway databases

ReactomeiR-HSA-2025928 Calcineurin activates NFAT
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-5607763 CLEC7A (Dectin-1) induces NFAT activation
SIGNORiQ12968

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NFATC3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NFATC3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4775

Protein Ontology

More...
PROi
PR:Q12968

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000072736 Expressed in 214 organ(s), highest expression level in leukocyte
CleanExiHS_NFATC3
ExpressionAtlasiQ12968 baseline and differential
GenevisibleiQ12968 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
2.60.40.340, 1 hit
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR008366 NFAT
IPR008967 p53-like_TF_DNA-bd
IPR032397 RHD_dimer
IPR011539 RHD_DNA_bind_dom
IPR037059 RHD_DNA_bind_dom_sf
PANTHERiPTHR12533 PTHR12533, 1 hit
PfamiView protein in Pfam
PF16179 RHD_dimer, 1 hit
PF00554 RHD_DNA_bind, 1 hit
PRINTSiPR01789 NUCFACTORATC
SMARTiView protein in SMART
SM00429 IPT, 1 hit
SUPFAMiSSF49417 SSF49417, 1 hit
SSF81296 SSF81296, 1 hit
PROSITEiView protein in PROSITE
PS50254 REL_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFAC3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12968
Secondary accession number(s): O75211
, Q14516, Q99840, Q99841, Q99842
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 184 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again