Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 184 (16 Oct 2019)
Sequence version 2 (20 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ral guanine nucleotide dissociation stimulator

Gene

RALGDS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-171007 p38MAPK events

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q12967

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator
Short name:
RalGDS
Alternative name(s):
Ral guanine nucleotide exchange factor
Short name:
RalGEF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RALGDS
Synonyms:KIAA1308, RGF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9842 RALGDS

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601619 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12967

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5900

Open Targets

More...
OpenTargetsi
ENSG00000160271

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34200

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q12967

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RALGDS

Domain mapping of disease mutations (DMDM)

More...
DMDMi
14549162

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000688771 – 914Ral guanine nucleotide dissociation stimulatorAdd BLAST914

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q12967

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q12967

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q12967

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q12967

PeptideAtlas

More...
PeptideAtlasi
Q12967

PRoteomics IDEntifications database

More...
PRIDEi
Q12967

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17741
17880
59058 [Q12967-1]
59059 [Q12967-2]
59060 [Q12967-3]
67063

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12967

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12967

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160271 Expressed in 231 organ(s), highest expression level in adenohypophysis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12967 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12967 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB032582
HPA025961

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RIT1 and RIT2.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111836, 24 interactors

Database of interacting proteins

More...
DIPi
DIP-31375N

Protein interaction database and analysis system

More...
IntActi
Q12967, 21 interactors

Molecular INTeraction database

More...
MINTi
Q12967

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361120

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1914
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q12967

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q12967

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini112 – 249N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST138
Domaini386 – 648Ras-GEFPROSITE-ProRule annotationAdd BLAST263
Domaini798 – 885Ras-associatingPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi714 – 717Poly-Ser4
Compositional biasi753 – 765Poly-SerAdd BLAST13
Compositional biasi839 – 844Poly-Glu6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Ras-associating domain interacts with Ras.

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3629 Eukaryota
ENOG410ZUT5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153181

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231592

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12967

KEGG Orthology (KO)

More...
KOi
K08732

Identification of Orthologs from Complete Genome Data

More...
OMAi
STRTHKR

Database of Orthologous Groups

More...
OrthoDBi
940219at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12967

TreeFam database of animal gene trees

More...
TreeFami
TF315204

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00155 RasGEF, 1 hit
cd06224 REM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.840.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000159 RA_dom
IPR015758 RalGDS
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR23113 PTHR23113, 1 hit
PTHR23113:SF35 PTHR23113:SF35, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12967-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQRMWAEAA GPAGGAEPLF PGSRRSRSVW DAVRLEVGVP DSCPVVLHSF
60 70 80 90 100
TQLDPDLPRP ESSTQEIGEE LINGVIYSIS LRKVQLHHGG NKGQRWLGYE
110 120 130 140 150
NESALNLYET CKVRTVKAGT LEKLVEHLVP AFQGSDLSYV TIFLCTYRAF
160 170 180 190 200
TTTQQVLDLL FKRYGRCDAL TASSRYGCIL PYSDEDGGPQ DQLKNAISSI
210 220 230 240 250
LGTWLDQYSE DFCQPPDFPC LKQLVAYVQL NMPGSDLERR AHLLLAQLEH
260 270 280 290 300
SEPIEAEPEA LSPVPALKPT PELELALTPA RAPSPVPAPA PEPEPAPTPA
310 320 330 340 350
PGSELEVAPA PAPELQQAPE PAVGLESAPA PALELEPAPE QDPAPSQTLE
360 370 380 390 400
LEPAPAPVPS LQPSWPSPVV AENGLSEEKP HLLVFPPDLV AEQFTLMDAE
410 420 430 440 450
LFKKVVPYHC LGSIWSQRDK KGKEHLAPTI RATVTQFNSV ANCVITTCLG
460 470 480 490 500
NRSTKAPDRA RVVEHWIEVA RECRILKNFS SLYAILSALQ SNSIHRLKKT
510 520 530 540 550
WEDVSRDSFR IFQKLSEIFS DENNYSLSRE LLIKEGTSKF ATLEMNPKRA
560 570 580 590 600
QKRPKETGII QGTVPYLGTF LTDLVMLDTA MKDYLYGRLI NFEKRRKEFE
610 620 630 640 650
VIAQIKLLQS ACNNYSIAPD EQFGAWFRAV ERLSETESYN LSCELEPPSE
660 670 680 690 700
SASNTLRTKK NTAIVKRWSD RQAPSTELST SGSSHSKSCD QLRCGPYLSS
710 720 730 740 750
GDIADALSVH SAGSSSSDVE EINISFVPES PDGQEKKFWE SASQSSPETS
760 770 780 790 800
GISSASSSTS SSSASTTPVA ATRTHKRSVS GLCNSSSALP LYNQQVGDCC
810 820 830 840 850
IIRVSLDVDN GNMYKSILVT SQDKAPAVIR KAMDKHNLEE EEPEDYELLQ
860 870 880 890 900
ILSDDRKLKI PENANVFYAM NSTANYDFVL KKRTFTKGVK VKHGASSTLP
910
RMKQKGLKIA KGIF
Length:914
Mass (Da):100,607
Last modified:June 20, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA5A5CF25AF3D523
GO
Isoform 2 (identifier: Q12967-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     738-912: FWESASQSSP...KQKGLKIAKG → VTACPSPQYP...KEQPCKAPRS

Note: No experimental confirmation available.
Show »
Length:951
Mass (Da):104,602
Checksum:i18593341C7EB71D5
GO
Isoform 3 (identifier: Q12967-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPE → MMVDCQ

Show »
Length:859
Mass (Da):94,690
Checksum:i938430024246A2BF
GO
Isoform 4 (identifier: Q12967-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MVQRMWAEAA...QLDPDLPRPE → MCLWGHSTAP...GHPPGQVPRK
     163-174: Missing.

Note: No experimental confirmation available.
Show »
Length:885
Mass (Da):97,325
Checksum:iFCA0A0092D93700F
GO
Isoform 5 (identifier: Q12967-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MVQRMWAEAA...TQLDPDLPRP → MAREAGQVCA...LAPLPAPATT

Note: No experimental confirmation available.Curated
Show »
Length:913
Mass (Da):100,323
Checksum:i238B0EF54522FD58
GO
Isoform 6 (identifier: Q12967-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     163-174: Missing.

Note: No experimental confirmation available.
Show »
Length:902
Mass (Da):99,325
Checksum:i5A4C99EB60D095DC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T7U6Q5T7U6_HUMAN
Ral guanine nucleotide dissociation...
RALGDS
308Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YEX4A0A2R8YEX4_HUMAN
Ral guanine nucleotide dissociation...
RALGDS
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YE90A0A2R8YE90_HUMAN
Ral guanine nucleotide dissociation...
RALGDS
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti97L → F in BAC87018 (PubMed:14702039).Curated1
Sequence conflicti869A → T in BAH13489 (PubMed:14702039).Curated1
Isoform 5 (identifier: Q12967-5)
Sequence conflicti3R → W in BAC87018 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035822496R → L in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0436591 – 61MVQRM…LPRPE → MMVDCQ in isoform 3. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0552151 – 61MVQRM…LPRPE → MCLWGHSTAPAHTLSSPPLL FCSLPCALHLQPGTGHPPGQ VPRK in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0552161 – 60MVQRM…DLPRP → MAREAGQVCARPAVPRGRKG SVFFACVSVVTARRRAVARR AALQSPTPWLAPLPAPATT in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_055217163 – 174Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_035301738 – 912FWESA…KIAKG → VTACPSPQYPFPSPHSKSMH GARKPWILNTASRRFPIWQL AWGAPTGQWDLLILPSPSVL GISLTVIPGDLRHQLSLQQH LVLLSLHHARGCHTHPQALC LRALQLQLRAAALQPAGGRL LYHPRQPGRGQWQHVQEHPG KPAGVAWVPPSTGGKCTLNT VHHPCPPGVYLVVGGEGQMS ARYRNEEGSDQGQGWPEGRG GGKEQPCKAPRS in isoform 2. 1 PublicationAdd BLAST175

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF295773 mRNA Translation: AAG02122.1
AK127524 mRNA Translation: BAC87018.1
AK301470 mRNA Translation: BAH13489.1
AF295775, AF295778 Genomic DNA Translation: AAG10221.1
AF295780 Genomic DNA Translation: AAG10225.1
AF027169 mRNA Translation: AAQ13414.1
AL162417 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88040.1
CH471090 Genomic DNA Translation: EAW88042.1
BC059362 mRNA Translation: AAH59362.1
AB037729 mRNA Translation: BAA92546.1
U14417 mRNA Translation: AAA52360.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43897.1 [Q12967-3]
CCDS65172.1 [Q12967-6]
CCDS65173.1 [Q12967-5]
CCDS65174.1 [Q12967-4]
CCDS6959.1 [Q12967-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
I38853

NCBI Reference Sequences

More...
RefSeqi
NP_001035827.1, NM_001042368.2 [Q12967-3]
NP_001258703.1, NM_001271774.1 [Q12967-4]
NP_001258704.1, NM_001271775.1 [Q12967-5]
NP_001258705.1, NM_001271776.1 [Q12967-6]
NP_006257.1, NM_006266.3 [Q12967-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372047; ENSP00000361117; ENSG00000160271 [Q12967-6]
ENST00000372050; ENSP00000361120; ENSG00000160271 [Q12967-1]
ENST00000372062; ENSP00000361132; ENSG00000160271 [Q12967-4]
ENST00000393157; ENSP00000376864; ENSG00000160271 [Q12967-5]
ENST00000393160; ENSP00000376867; ENSG00000160271 [Q12967-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5900

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5900

UCSC genome browser

More...
UCSCi
uc004cco.5 human [Q12967-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF295773 mRNA Translation: AAG02122.1
AK127524 mRNA Translation: BAC87018.1
AK301470 mRNA Translation: BAH13489.1
AF295775, AF295778 Genomic DNA Translation: AAG10221.1
AF295780 Genomic DNA Translation: AAG10225.1
AF027169 mRNA Translation: AAQ13414.1
AL162417 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88040.1
CH471090 Genomic DNA Translation: EAW88042.1
BC059362 mRNA Translation: AAH59362.1
AB037729 mRNA Translation: BAA92546.1
U14417 mRNA Translation: AAA52360.1
CCDSiCCDS43897.1 [Q12967-3]
CCDS65172.1 [Q12967-6]
CCDS65173.1 [Q12967-5]
CCDS65174.1 [Q12967-4]
CCDS6959.1 [Q12967-1]
PIRiI38853
RefSeqiNP_001035827.1, NM_001042368.2 [Q12967-3]
NP_001258703.1, NM_001271774.1 [Q12967-4]
NP_001258704.1, NM_001271775.1 [Q12967-5]
NP_001258705.1, NM_001271776.1 [Q12967-6]
NP_006257.1, NM_006266.3 [Q12967-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RAXNMR-A775-886[»]
2B3ANMR-A798-884[»]
2RGFNMR-A788-884[»]
3KH0X-ray2.10A/B793-914[»]
SMRiQ12967
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi111836, 24 interactors
DIPiDIP-31375N
IntActiQ12967, 21 interactors
MINTiQ12967
STRINGi9606.ENSP00000361120

PTM databases

iPTMnetiQ12967
PhosphoSitePlusiQ12967

Polymorphism and mutation databases

BioMutaiRALGDS
DMDMi14549162

Proteomic databases

jPOSTiQ12967
MassIVEiQ12967
MaxQBiQ12967
PaxDbiQ12967
PeptideAtlasiQ12967
PRIDEiQ12967
ProteomicsDBi17741
17880
59058 [Q12967-1]
59059 [Q12967-2]
59060 [Q12967-3]
67063

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5900

Genome annotation databases

EnsembliENST00000372047; ENSP00000361117; ENSG00000160271 [Q12967-6]
ENST00000372050; ENSP00000361120; ENSG00000160271 [Q12967-1]
ENST00000372062; ENSP00000361132; ENSG00000160271 [Q12967-4]
ENST00000393157; ENSP00000376864; ENSG00000160271 [Q12967-5]
ENST00000393160; ENSP00000376867; ENSG00000160271 [Q12967-3]
GeneIDi5900
KEGGihsa:5900
UCSCiuc004cco.5 human [Q12967-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5900
DisGeNETi5900

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RALGDS
HGNCiHGNC:9842 RALGDS
HPAiCAB032582
HPA025961
MIMi601619 gene
neXtProtiNX_Q12967
OpenTargetsiENSG00000160271
PharmGKBiPA34200

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3629 Eukaryota
ENOG410ZUT5 LUCA
GeneTreeiENSGT00940000153181
HOGENOMiHOG000231592
InParanoidiQ12967
KOiK08732
OMAiSTRTHKR
OrthoDBi940219at2759
PhylomeDBiQ12967
TreeFamiTF315204

Enzyme and pathway databases

ReactomeiR-HSA-171007 p38MAPK events
SIGNORiQ12967

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RALGDS human
EvolutionaryTraceiQ12967

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RALGDS

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5900
PharosiQ12967

Protein Ontology

More...
PROi
PR:Q12967

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160271 Expressed in 231 organ(s), highest expression level in adenohypophysis
ExpressionAtlasiQ12967 baseline and differential
GenevisibleiQ12967 HS

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR015758 RalGDS
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF35 PTHR23113:SF35, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGNDS_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12967
Secondary accession number(s): B7Z753
, E7ER93, E7ERZ0, Q5T7V4, Q6KH11, Q6PCE1, Q6ZSD5, Q9HAX7, Q9HAY1, Q9HCT1, Q9P2N8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 20, 2001
Last modified: October 16, 2019
This is version 184 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again