Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral guanine nucleotide dissociation stimulator

Gene

RALGDS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap.

GO - Molecular functioni

  • GTPase regulator activity Source: UniProtKB
  • guanyl-nucleotide exchange factor activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-171007 p38MAPK events
SIGNORiQ12967

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator
Short name:
RalGDS
Alternative name(s):
Ral guanine nucleotide exchange factor
Short name:
RalGEF
Gene namesi
Name:RALGDS
Synonyms:KIAA1308, RGF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000160271.14
HGNCiHGNC:9842 RALGDS
MIMi601619 gene
neXtProtiNX_Q12967

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5900
OpenTargetsiENSG00000160271
PharmGKBiPA34200

Polymorphism and mutation databases

DMDMi14549162

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688771 – 914Ral guanine nucleotide dissociation stimulatorAdd BLAST914

Proteomic databases

MaxQBiQ12967
PaxDbiQ12967
PeptideAtlasiQ12967
PRIDEiQ12967
ProteomicsDBi59058
59059 [Q12967-2]
59060 [Q12967-3]

PTM databases

iPTMnetiQ12967
PhosphoSitePlusiQ12967

Expressioni

Gene expression databases

BgeeiENSG00000160271 Expressed in 231 organ(s), highest expression level in adenohypophysis
CleanExiHS_RALGDS
ExpressionAtlasiQ12967 baseline and differential
GenevisibleiQ12967 HS

Organism-specific databases

HPAiCAB032582
HPA025961

Interactioni

Subunit structurei

Interacts with RIT1 and RIT2.By similarity

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111836, 23 interactors
DIPiDIP-31375N
IntActiQ12967, 20 interactors
MINTiQ12967
STRINGi9606.ENSP00000361120

Structurei

Secondary structure

1914
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ12967
SMRiQ12967
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ12967

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini112 – 249N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST138
Domaini386 – 648Ras-GEFPROSITE-ProRule annotationAdd BLAST263
Domaini798 – 885Ras-associatingPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi714 – 717Poly-Ser4
Compositional biasi753 – 765Poly-SerAdd BLAST13
Compositional biasi839 – 844Poly-Glu6

Domaini

The Ras-associating domain interacts with Ras.

Phylogenomic databases

eggNOGiKOG3629 Eukaryota
ENOG410ZUT5 LUCA
GeneTreeiENSGT00910000143985
HOGENOMiHOG000231592
HOVERGENiHBG005864
InParanoidiQ12967
KOiK08732
OMAiNDSTYVT
OrthoDBiEOG091G0761
PhylomeDBiQ12967
TreeFamiTF315204

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR015758 RalGDS
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF35 PTHR23113:SF35, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12967-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQRMWAEAA GPAGGAEPLF PGSRRSRSVW DAVRLEVGVP DSCPVVLHSF
60 70 80 90 100
TQLDPDLPRP ESSTQEIGEE LINGVIYSIS LRKVQLHHGG NKGQRWLGYE
110 120 130 140 150
NESALNLYET CKVRTVKAGT LEKLVEHLVP AFQGSDLSYV TIFLCTYRAF
160 170 180 190 200
TTTQQVLDLL FKRYGRCDAL TASSRYGCIL PYSDEDGGPQ DQLKNAISSI
210 220 230 240 250
LGTWLDQYSE DFCQPPDFPC LKQLVAYVQL NMPGSDLERR AHLLLAQLEH
260 270 280 290 300
SEPIEAEPEA LSPVPALKPT PELELALTPA RAPSPVPAPA PEPEPAPTPA
310 320 330 340 350
PGSELEVAPA PAPELQQAPE PAVGLESAPA PALELEPAPE QDPAPSQTLE
360 370 380 390 400
LEPAPAPVPS LQPSWPSPVV AENGLSEEKP HLLVFPPDLV AEQFTLMDAE
410 420 430 440 450
LFKKVVPYHC LGSIWSQRDK KGKEHLAPTI RATVTQFNSV ANCVITTCLG
460 470 480 490 500
NRSTKAPDRA RVVEHWIEVA RECRILKNFS SLYAILSALQ SNSIHRLKKT
510 520 530 540 550
WEDVSRDSFR IFQKLSEIFS DENNYSLSRE LLIKEGTSKF ATLEMNPKRA
560 570 580 590 600
QKRPKETGII QGTVPYLGTF LTDLVMLDTA MKDYLYGRLI NFEKRRKEFE
610 620 630 640 650
VIAQIKLLQS ACNNYSIAPD EQFGAWFRAV ERLSETESYN LSCELEPPSE
660 670 680 690 700
SASNTLRTKK NTAIVKRWSD RQAPSTELST SGSSHSKSCD QLRCGPYLSS
710 720 730 740 750
GDIADALSVH SAGSSSSDVE EINISFVPES PDGQEKKFWE SASQSSPETS
760 770 780 790 800
GISSASSSTS SSSASTTPVA ATRTHKRSVS GLCNSSSALP LYNQQVGDCC
810 820 830 840 850
IIRVSLDVDN GNMYKSILVT SQDKAPAVIR KAMDKHNLEE EEPEDYELLQ
860 870 880 890 900
ILSDDRKLKI PENANVFYAM NSTANYDFVL KKRTFTKGVK VKHGASSTLP
910
RMKQKGLKIA KGIF
Length:914
Mass (Da):100,607
Last modified:June 20, 2001 - v2
Checksum:iEA5A5CF25AF3D523
GO
Isoform 2 (identifier: Q12967-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     738-912: FWESASQSSP...KQKGLKIAKG → VTACPSPQYP...KEQPCKAPRS

Note: No experimental confirmation available.
Show »
Length:951
Mass (Da):104,602
Checksum:i18593341C7EB71D5
GO
Isoform 3 (identifier: Q12967-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPE → MMVDCQ

Show »
Length:859
Mass (Da):94,690
Checksum:i938430024246A2BF
GO
Isoform 4 (identifier: Q12967-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MVQRMWAEAA...QLDPDLPRPE → MCLWGHSTAP...GHPPGQVPRK
     163-174: Missing.

Note: No experimental confirmation available.
Show »
Length:885
Mass (Da):97,325
Checksum:iFCA0A0092D93700F
GO
Isoform 5 (identifier: Q12967-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MVQRMWAEAA...TQLDPDLPRP → MAREAGQVCA...LAPLPAPATT

Note: No experimental confirmation available.Curated
Show »
Length:913
Mass (Da):100,323
Checksum:i238B0EF54522FD58
GO
Isoform 6 (identifier: Q12967-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     163-174: Missing.

Note: No experimental confirmation available.
Show »
Length:902
Mass (Da):99,325
Checksum:i5A4C99EB60D095DC
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T7U6Q5T7U6_HUMAN
Ral guanine nucleotide dissociation...
RALGDS
308Annotation score:
A0A2R8YE90A0A2R8YE90_HUMAN
Ral guanine nucleotide dissociation...
RALGDS
147Annotation score:
A0A2R8YEX4A0A2R8YEX4_HUMAN
Ral guanine nucleotide dissociation...
RALGDS
95Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti97L → F in BAC87018 (PubMed:14702039).Curated1
Sequence conflicti869A → T in BAH13489 (PubMed:14702039).Curated1
Isoform 5 (identifier: Q12967-5)
Sequence conflicti3R → W in BAC87018 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035822496R → L in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0436591 – 61MVQRM…LPRPE → MMVDCQ in isoform 3. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0552151 – 61MVQRM…LPRPE → MCLWGHSTAPAHTLSSPPLL FCSLPCALHLQPGTGHPPGQ VPRK in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0552161 – 60MVQRM…DLPRP → MAREAGQVCARPAVPRGRKG SVFFACVSVVTARRRAVARR AALQSPTPWLAPLPAPATT in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_055217163 – 174Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_035301738 – 912FWESA…KIAKG → VTACPSPQYPFPSPHSKSMH GARKPWILNTASRRFPIWQL AWGAPTGQWDLLILPSPSVL GISLTVIPGDLRHQLSLQQH LVLLSLHHARGCHTHPQALC LRALQLQLRAAALQPAGGRL LYHPRQPGRGQWQHVQEHPG KPAGVAWVPPSTGGKCTLNT VHHPCPPGVYLVVGGEGQMS ARYRNEEGSDQGQGWPEGRG GGKEQPCKAPRS in isoform 2. 1 PublicationAdd BLAST175

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF295773 mRNA Translation: AAG02122.1
AK127524 mRNA Translation: BAC87018.1
AK301470 mRNA Translation: BAH13489.1
AF295775, AF295778 Genomic DNA Translation: AAG10221.1
AF295780 Genomic DNA Translation: AAG10225.1
AF027169 mRNA Translation: AAQ13414.1
AL162417 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88040.1
CH471090 Genomic DNA Translation: EAW88042.1
BC059362 mRNA Translation: AAH59362.1
AB037729 mRNA Translation: BAA92546.1
U14417 mRNA Translation: AAA52360.1
CCDSiCCDS43897.1 [Q12967-3]
CCDS65172.1 [Q12967-6]
CCDS65173.1 [Q12967-5]
CCDS65174.1 [Q12967-4]
CCDS6959.1 [Q12967-1]
PIRiI38853
RefSeqiNP_001035827.1, NM_001042368.2 [Q12967-3]
NP_001258703.1, NM_001271774.1 [Q12967-4]
NP_001258704.1, NM_001271775.1 [Q12967-5]
NP_001258705.1, NM_001271776.1 [Q12967-6]
NP_006257.1, NM_006266.3 [Q12967-1]
UniGeneiHs.106185

Genome annotation databases

EnsembliENST00000372047; ENSP00000361117; ENSG00000160271 [Q12967-6]
ENST00000372050; ENSP00000361120; ENSG00000160271 [Q12967-1]
ENST00000372062; ENSP00000361132; ENSG00000160271 [Q12967-4]
ENST00000393157; ENSP00000376864; ENSG00000160271 [Q12967-5]
ENST00000393160; ENSP00000376867; ENSG00000160271 [Q12967-3]
GeneIDi5900
KEGGihsa:5900
UCSCiuc004cco.5 human [Q12967-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF295773 mRNA Translation: AAG02122.1
AK127524 mRNA Translation: BAC87018.1
AK301470 mRNA Translation: BAH13489.1
AF295775, AF295778 Genomic DNA Translation: AAG10221.1
AF295780 Genomic DNA Translation: AAG10225.1
AF027169 mRNA Translation: AAQ13414.1
AL162417 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88040.1
CH471090 Genomic DNA Translation: EAW88042.1
BC059362 mRNA Translation: AAH59362.1
AB037729 mRNA Translation: BAA92546.1
U14417 mRNA Translation: AAA52360.1
CCDSiCCDS43897.1 [Q12967-3]
CCDS65172.1 [Q12967-6]
CCDS65173.1 [Q12967-5]
CCDS65174.1 [Q12967-4]
CCDS6959.1 [Q12967-1]
PIRiI38853
RefSeqiNP_001035827.1, NM_001042368.2 [Q12967-3]
NP_001258703.1, NM_001271774.1 [Q12967-4]
NP_001258704.1, NM_001271775.1 [Q12967-5]
NP_001258705.1, NM_001271776.1 [Q12967-6]
NP_006257.1, NM_006266.3 [Q12967-1]
UniGeneiHs.106185

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RAXNMR-A775-886[»]
2B3ANMR-A798-884[»]
2RGFNMR-A788-884[»]
3KH0X-ray2.10A/B793-914[»]
ProteinModelPortaliQ12967
SMRiQ12967
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111836, 23 interactors
DIPiDIP-31375N
IntActiQ12967, 20 interactors
MINTiQ12967
STRINGi9606.ENSP00000361120

PTM databases

iPTMnetiQ12967
PhosphoSitePlusiQ12967

Polymorphism and mutation databases

DMDMi14549162

Proteomic databases

MaxQBiQ12967
PaxDbiQ12967
PeptideAtlasiQ12967
PRIDEiQ12967
ProteomicsDBi59058
59059 [Q12967-2]
59060 [Q12967-3]

Protocols and materials databases

DNASUi5900
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372047; ENSP00000361117; ENSG00000160271 [Q12967-6]
ENST00000372050; ENSP00000361120; ENSG00000160271 [Q12967-1]
ENST00000372062; ENSP00000361132; ENSG00000160271 [Q12967-4]
ENST00000393157; ENSP00000376864; ENSG00000160271 [Q12967-5]
ENST00000393160; ENSP00000376867; ENSG00000160271 [Q12967-3]
GeneIDi5900
KEGGihsa:5900
UCSCiuc004cco.5 human [Q12967-1]

Organism-specific databases

CTDi5900
DisGeNETi5900
EuPathDBiHostDB:ENSG00000160271.14
GeneCardsiRALGDS
H-InvDBiHIX0008210
HGNCiHGNC:9842 RALGDS
HPAiCAB032582
HPA025961
MIMi601619 gene
neXtProtiNX_Q12967
OpenTargetsiENSG00000160271
PharmGKBiPA34200
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3629 Eukaryota
ENOG410ZUT5 LUCA
GeneTreeiENSGT00910000143985
HOGENOMiHOG000231592
HOVERGENiHBG005864
InParanoidiQ12967
KOiK08732
OMAiNDSTYVT
OrthoDBiEOG091G0761
PhylomeDBiQ12967
TreeFamiTF315204

Enzyme and pathway databases

ReactomeiR-HSA-171007 p38MAPK events
SIGNORiQ12967

Miscellaneous databases

ChiTaRSiRALGDS human
EvolutionaryTraceiQ12967
GeneWikiiRALGDS
GenomeRNAii5900
PROiPR:Q12967
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000160271 Expressed in 231 organ(s), highest expression level in adenohypophysis
CleanExiHS_RALGDS
ExpressionAtlasiQ12967 baseline and differential
GenevisibleiQ12967 HS

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR015758 RalGDS
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF35 PTHR23113:SF35, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGNDS_HUMAN
AccessioniPrimary (citable) accession number: Q12967
Secondary accession number(s): B7Z753
, E7ER93, E7ERZ0, Q5T7V4, Q6KH11, Q6PCE1, Q6ZSD5, Q9HAX7, Q9HAY1, Q9HCT1, Q9P2N8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 20, 2001
Last modified: November 7, 2018
This is version 177 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again