Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 217 (13 Feb 2019)
Sequence version 2 (10 Feb 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Disks large homolog 1

Gene

DLG1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential multidomain scaffolding protein required for normal development (By similarity). Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels. Functional regulator of Kv1.5 channel.By similarity6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHost-virus interaction

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-8849932 Synaptic adhesion-like molecules
R-HSA-9617324 Negative regulation of NMDA receptor-mediated neuronal transmission
R-HSA-9620244 Long-term potentiation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q12959

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.24.1.7 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large homolog 1Curated
Alternative name(s):
Synapse-associated protein 97
Short name:
SAP-97
Short name:
SAP97
hDlg
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DLG1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000075711.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2900 DLG1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601014 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12959

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi38 – 40INI → ANA: Loss of membrane association and DLG2-binding. 1 Publication3

Organism-specific databases

DisGeNET

More...
DisGeNETi
1739

MalaCards human disease database

More...
MalaCardsi
DLG1

Open Targets

More...
OpenTargetsi
ENSG00000075711

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
199306 Cleft lip/palate

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27356

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DLG1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
223590196

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945481 – 904Disks large homolog 1Add BLAST904

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei115PhosphothreonineCombined sources1
Modified residuei122PhosphoserineCombined sources1
Modified residuei138PhosphoserineCombined sources1
Modified residuei158PhosphoserineCombined sources1
Modified residuei232PhosphoserineBy similarity1
Modified residuei399PhosphotyrosineBy similarity1
Modified residuei568PhosphoserineCombined sources1
Modified residuei573PhosphoserineCombined sources1
Modified residuei575PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei598PhosphoserineBy similarity1
Modified residuei619PhosphoserineCombined sources1
Modified residuei684PhosphoserineCombined sources1
Modified residuei687PhosphoserineCombined sources1
Modified residuei834PhosphoserineBy similarity1
Isoform 4 (identifier: Q12959-4)
Modified residuei676PhosphoserineCombined sourcesCurated1
Isoform 2 (identifier: Q12959-2)
Modified residuei709PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by MAPK12. Phosphorylation of Ser-232 regulates association with GRIN2A (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q12959

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q12959

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q12959

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q12959

PeptideAtlas

More...
PeptideAtlasi
Q12959

PRoteomics IDEntifications database

More...
PRIDEi
Q12959

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59049
59050 [Q12959-2]
59051 [Q12959-3]
59052 [Q12959-4]
59053 [Q12959-5]
59054 [Q12959-6]
59055 [Q12959-7]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1182

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12959

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12959

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q12959

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundantly expressed in atrial myocardium (at protein level). Expressed in lung fibroblasts, cervical epithelial and B-cells (at protein level). Widely expressed, with isoforms displaying different expression profiles.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000075711 Expressed in 232 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12959 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12959 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016307
HPA069593

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer (Probable). Interacts (via guanylate kinase-like domain) with DLGAP1, DLGAP2, DLGAP3, DLGAP4 and MAP1A (By similarity). Interacts (via guanylate kinase-like domain) with KIF13B (PubMed:10859302). May interact with HTR2A (By similarity). Interacts (via PDZ domains) with GRIA1 (By similarity). Interacts (via PDZ domains) with GRIN2A (By similarity). Interacts (via PDZ domains) with KCND2 and KCND3 (PubMed:19213956). Interacts (via PDZ domains) with KCNA1, KCNA2, KCNA3 and KCNA4 (PubMed:7477295). Interacts (via PDZ domains) with ADGRA3 (PubMed:15021905). Interacts with KCNF1 (PubMed:12445884). Interacts with CAMK2 (By similarity). Interacts with cytoskeleton-associated protein EPB41 (PubMed:7937897, PubMed:8922391). Interacts with cytoskeleton-associated protein EZR (By similarity). Found in a complex with KCNA5 and CAV3 (By similarity). Found in a complex with APC and CTNNB1 (PubMed:8638125, PubMed:10656683). Interacts with CDH1 through binding to PIK3R1 (PubMed:14699157). Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12 (By similarity). Interacts with TOPK (PubMed:10779557). Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C) (PubMed:17237226, PubMed:17332497, PubMed:20702775). May interact with TJAP1 (PubMed:11602598). Interacts with PTEN (By similarity). Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835). Interacts with SFPQ (PubMed:20605917). Interacts (via PDZ domains) with ADGRA2 (via PDZ-binding motif) (PubMed:15021905, PubMed:25558062).By similarityCurated18 Publications
(Microbial infection) Interacts with HTLV-1 protein Tax.1 Publication
(Microbial infection) Interacts with human papillomavirus 18/HPV-18 protein E6.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108083, 69 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q12959

Database of interacting proteins

More...
DIPi
DIP-33957N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q12959

Protein interaction database and analysis system

More...
IntActi
Q12959, 134 interactors

Molecular INTeraction database

More...
MINTi
Q12959

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000345731

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1904
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PDRX-ray2.80A457-555[»]
2M3MNMR-A318-406[»]
2OQSNMR-A318-406[»]
2X7ZX-ray2.00A311-407[»]
3LRAX-ray2.95A2-65[»]
3RL7X-ray2.30A/B/C/D/E/F220-317[»]
3RL8X-ray2.20A/B/C/D/E315-410[»]
3W9YX-ray2.20A712-904[»]
4AMHX-ray2.30A/B315-405[»]
4G69X-ray2.00A310-407[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q12959

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q12959

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q12959

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 64L27PROSITE-ProRule annotationAdd BLAST61
Domaini224 – 310PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini319 – 405PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini466 – 546PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini581 – 651SH3PROSITE-ProRule annotationAdd BLAST71
Domaini714 – 889Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni162 – 212Interaction with SH3 domainsAdd BLAST51

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The alternatively spliced domain I3 corresponding to amino acids (636-669) of isoform 4 is an EPB41 binding site mediating association to membranes in polarized and non-polarized cells.
The PDZ domains may also mediate association to membranes by binding to EPB41 and ADGRA2 together with the L27 domain that binds CASK and DLG2.
The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159409

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232102

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107814

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12959

KEGG Orthology (KO)

More...
KOi
K12076

Identification of Orthologs from Complete Genome Data

More...
OMAi
VDNHISP

Database of Orthologous Groups

More...
OrthoDBi
807583at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12959

TreeFam database of animal gene trees

More...
TreeFami
TF323171

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001741 MAGUK_DLGH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12959-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVRKQDTQR ALHLLEEYRS KLSQTEDRQL RSSIERVINI FQSNLFQALI
60 70 80 90 100
DIQEFYEVTL LDNPKCIDRS KPSEPIQPVN TWEISSLPSS TVTSETLPSS
110 120 130 140 150
LSPSVEKYRY QDEDTPPQEH ISPQITNEVI GPELVHVSEK NLSEIENVHG
160 170 180 190 200
FVSHSHISPI KPTEAVLPSP PTVPVIPVLP VPAENTVILP TIPQANPPPV
210 220 230 240 250
LVNTDSLETP TYVNGTDADY EYEEITLERG NSGLGFSIAG GTDNPHIGDD
260 270 280 290 300
SSIFITKIIT GGAAAQDGRL RVNDCILRVN EVDVRDVTHS KAVEALKEAG
310 320 330 340 350
SIVRLYVKRR KPVSEKIMEI KLIKGPKGLG FSIAGGVGNQ HIPGDNSIYV
360 370 380 390 400
TKIIEGGAAH KDGKLQIGDK LLAVNNVCLE EVTHEEAVTA LKNTSDFVYL
410 420 430 440 450
KVAKPTSMYM NDGYAPPDIT NSSSQPVDNH VSPSSFLGQT PASPARYSPV
460 470 480 490 500
SKAVLGDDEI TREPRKVVLH RGSTGLGFNI VGGEDGEGIF ISFILAGGPA
510 520 530 540 550
DLSGELRKGD RIISVNSVDL RAASHEQAAA ALKNAGQAVT IVAQYRPEEY
560 570 580 590 600
SRFEAKIHDL REQMMNSSIS SGSGSLRTSQ KRSLYVRALF DYDKTKDSGL
610 620 630 640 650
PSQGLNFKFG DILHVINASD DEWWQARQVT PDGESDEVGV IPSKRRVEKK
660 670 680 690 700
ERARLKTVKF NSKTRDKGEI PDDMGSKGLK HVTSNASDSE SSYRGQEEYV
710 720 730 740 750
LSYEPVNQQE VNYTRPVIIL GPMKDRINDD LISEFPDKFG SCVPHTTRPK
760 770 780 790 800
RDYEVDGRDY HFVTSREQME KDIQEHKFIE AGQYNNHLYG TSVQSVREVA
810 820 830 840 850
EKGKHCILDV SGNAIKRLQI AQLYPISIFI KPKSMENIME MNKRLTEEQA
860 870 880 890 900
RKTFERAMKL EQEFTEHFTA IVQGDTLEDI YNQVKQIIEE QSGSYIWVPA

KEKL
Length:904
Mass (Da):100,455
Last modified:February 10, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6722993A84D0F761
GO
Isoform 2 (identifier: Q12959-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-680: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:926
Mass (Da):103,321
Checksum:i85BD4E93A17D74C4
GO
Isoform 3 (identifier: Q12959-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.

Show »
Length:871
Mass (Da):97,076
Checksum:i78CB64FC6DE66BB1
GO
Isoform 4 (identifier: Q12959-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     669-680: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:893
Mass (Da):99,942
Checksum:i3A026E9BAA62FFB7
GO
Isoform 5 (identifier: Q12959-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     195-212: Missing.

Show »
Length:853
Mass (Da):95,166
Checksum:i2E7EE3F5954BA3E0
GO
Isoform 6 (identifier: Q12959-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     681-693: Missing.

Show »
Length:891
Mass (Da):99,090
Checksum:i5DB5256100623D0B
GO
Isoform 7 (identifier: Q12959-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     693-693: Y → YLILITDEYGCSKG

Show »
Length:917
Mass (Da):101,849
Checksum:iFE8911BB05B03211
GO
Isoform 8 (identifier: Q12959-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: MPVRKQDTQR...DRSKPSEPIQ → MNYIFGNNTL...DCISVATSST
     78-193: Missing.

Note: No experimental confirmation available.
Show »
Length:788
Mass (Da):87,248
Checksum:i8EB77B3368768FBD
GO
Isoform 9 (identifier: Q12959-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: MPVRKQDTQR...DRSKPSEPIQ → MNYIFGNNTL...DCISVATSST
     78-193: Missing.
     693-693: Y → YLILITDEYGCSKG
     694-694: Missing.

Note: No experimental confirmation available.
Show »
Length:800
Mass (Da):88,485
Checksum:iC67306E88A5A473D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DFT3A0A0C4DFT3_HUMAN
Disks large homolog 1
DLG1
892Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MUT6A8MUT6_HUMAN
Disks large homolog 1
DLG1
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQD7E7EQD7_HUMAN
Disks large homolog 1
DLG1
658Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JN61C9JN61_HUMAN
Disks large homolog 1
DLG1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4E2H8B4E2H8_HUMAN
cDNA FLJ58166, highly similar to Di...
DLG1
370Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JUA9C9JUA9_HUMAN
Disks large homolog 1
DLG1
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCP6C9JCP6_HUMAN
Disks large homolog 1
DLG1
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2L0F2Z2L0_HUMAN
Disks large homolog 1
DLG1
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C166H7C166_HUMAN
Disks large homolog 1
DLG1
286Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IYP1C9IYP1_HUMAN
Disks large homolog 1
DLG1
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti237S → N in BAG57902 (PubMed:14702039).Curated1
Sequence conflicti801E → G in AAA50598 (PubMed:7937897).Curated1
Sequence conflicti801E → G in AAA50599 (PubMed:7937897).Curated1
Isoform 4 (identifier: Q12959-4)
Sequence conflicti636Missing in AAI44652 (PubMed:15489334).Combined sourcesCurated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_054334140K → R. Corresponds to variant dbSNP:rs1802668Ensembl.1
Natural variantiVAR_054335278R → Q2 PublicationsCorresponds to variant dbSNP:rs1134986Ensembl.1
Natural variantiVAR_054336899P → L. Corresponds to variant dbSNP:rs34492126Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0458961 – 77MPVRK…SEPIQ → MNYIFGNNTLLYSRGSRGGN TSSSHGSAGPKQKHWAKKGS SDELQAEPEPSRWQQIVAFF TRRHSFIDCISVATSST in isoform 8 and isoform 9. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_04589778 – 193Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_012862162 – 194Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_012863195 – 212Missing in isoform 5. CuratedAdd BLAST18
Alternative sequenceiVSP_003150669 – 680EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 2 and isoform 4. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_012864681 – 693Missing in isoform 6. CuratedAdd BLAST13
Alternative sequenceiVSP_012865693Y → YLILITDEYGCSKG in isoform 7 and isoform 9. 1 Publication1
Alternative sequenceiVSP_045898694Missing in isoform 9. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U13896 mRNA Translation: AAA50598.1
U13897 mRNA Translation: AAA50599.1
AK294772 mRNA Translation: BAG57902.1
AK294855 mRNA Translation: BAG57959.1
EF553524 mRNA Translation: ABQ66269.1
AC068302 Genomic DNA No translation available.
AC092937 Genomic DNA No translation available.
CH471191 Genomic DNA Translation: EAW53610.1
CH471191 Genomic DNA Translation: EAW53611.1
CH471191 Genomic DNA Translation: EAW53612.1
CH471191 Genomic DNA Translation: EAW53614.1
BC140841 mRNA Translation: AAI40842.1
BC144651 mRNA Translation: AAI44652.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3327.1 [Q12959-2]
CCDS43194.1 [Q12959-1]
CCDS56300.1 [Q12959-8]
CCDS56301.1 [Q12959-9]
CCDS87192.1 [Q12959-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
I38756
I38757

NCBI Reference Sequences

More...
RefSeqi
NP_001091894.1, NM_001098424.1 [Q12959-1]
NP_001191315.1, NM_001204386.1
NP_001191316.1, NM_001204387.1 [Q12959-9]
NP_001191317.1, NM_001204388.1 [Q12959-8]
NP_001277912.1, NM_001290983.1 [Q12959-1]
NP_004078.2, NM_004087.2 [Q12959-2]
XP_005269346.1, XM_005269289.3 [Q12959-2]
XP_011510804.1, XM_011512502.2 [Q12959-1]
XP_011510805.1, XM_011512503.1
XP_011510807.1, XM_011512505.1 [Q12959-3]
XP_011510808.1, XM_011512506.1 [Q12959-5]
XP_016861289.1, XM_017005800.1 [Q12959-2]
XP_016861290.1, XM_017005801.1 [Q12959-2]
XP_016861291.1, XM_017005802.1 [Q12959-2]
XP_016861292.1, XM_017005803.1 [Q12959-2]
XP_016861294.1, XM_017005805.1 [Q12959-1]
XP_016861295.1, XM_017005806.1 [Q12959-4]
XP_016861296.1, XM_017005807.1 [Q12959-4]
XP_016861297.1, XM_017005808.1 [Q12959-4]
XP_016861298.1, XM_017005809.1
XP_016861299.1, XM_017005810.1
XP_016861305.1, XM_017005816.1 [Q12959-3]
XP_016861306.1, XM_017005817.1 [Q12959-3]
XP_016861307.1, XM_017005818.1 [Q12959-3]
XP_016861308.1, XM_017005819.1 [Q12959-3]
XP_016861309.1, XM_017005820.1 [Q12959-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.292549

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000346964; ENSP00000345731; ENSG00000075711 [Q12959-2]
ENST00000392382; ENSP00000376187; ENSG00000075711 [Q12959-3]
ENST00000419354; ENSP00000407531; ENSG00000075711 [Q12959-1]
ENST00000422288; ENSP00000413238; ENSG00000075711 [Q12959-5]
ENST00000443183; ENSP00000396658; ENSG00000075711 [Q12959-9]
ENST00000448528; ENSP00000391732; ENSG00000075711 [Q12959-1]
ENST00000450955; ENSP00000411278; ENSG00000075711 [Q12959-4]
ENST00000452595; ENSP00000398939; ENSG00000075711 [Q12959-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1739

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1739

UCSC genome browser

More...
UCSCi
uc003fxn.4 human [Q12959-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U13896 mRNA Translation: AAA50598.1
U13897 mRNA Translation: AAA50599.1
AK294772 mRNA Translation: BAG57902.1
AK294855 mRNA Translation: BAG57959.1
EF553524 mRNA Translation: ABQ66269.1
AC068302 Genomic DNA No translation available.
AC092937 Genomic DNA No translation available.
CH471191 Genomic DNA Translation: EAW53610.1
CH471191 Genomic DNA Translation: EAW53611.1
CH471191 Genomic DNA Translation: EAW53612.1
CH471191 Genomic DNA Translation: EAW53614.1
BC140841 mRNA Translation: AAI40842.1
BC144651 mRNA Translation: AAI44652.1
CCDSiCCDS3327.1 [Q12959-2]
CCDS43194.1 [Q12959-1]
CCDS56300.1 [Q12959-8]
CCDS56301.1 [Q12959-9]
CCDS87192.1 [Q12959-4]
PIRiI38756
I38757
RefSeqiNP_001091894.1, NM_001098424.1 [Q12959-1]
NP_001191315.1, NM_001204386.1
NP_001191316.1, NM_001204387.1 [Q12959-9]
NP_001191317.1, NM_001204388.1 [Q12959-8]
NP_001277912.1, NM_001290983.1 [Q12959-1]
NP_004078.2, NM_004087.2 [Q12959-2]
XP_005269346.1, XM_005269289.3 [Q12959-2]
XP_011510804.1, XM_011512502.2 [Q12959-1]
XP_011510805.1, XM_011512503.1
XP_011510807.1, XM_011512505.1 [Q12959-3]
XP_011510808.1, XM_011512506.1 [Q12959-5]
XP_016861289.1, XM_017005800.1 [Q12959-2]
XP_016861290.1, XM_017005801.1 [Q12959-2]
XP_016861291.1, XM_017005802.1 [Q12959-2]
XP_016861292.1, XM_017005803.1 [Q12959-2]
XP_016861294.1, XM_017005805.1 [Q12959-1]
XP_016861295.1, XM_017005806.1 [Q12959-4]
XP_016861296.1, XM_017005807.1 [Q12959-4]
XP_016861297.1, XM_017005808.1 [Q12959-4]
XP_016861298.1, XM_017005809.1
XP_016861299.1, XM_017005810.1
XP_016861305.1, XM_017005816.1 [Q12959-3]
XP_016861306.1, XM_017005817.1 [Q12959-3]
XP_016861307.1, XM_017005818.1 [Q12959-3]
XP_016861308.1, XM_017005819.1 [Q12959-3]
XP_016861309.1, XM_017005820.1 [Q12959-5]
UniGeneiHs.292549

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PDRX-ray2.80A457-555[»]
2M3MNMR-A318-406[»]
2OQSNMR-A318-406[»]
2X7ZX-ray2.00A311-407[»]
3LRAX-ray2.95A2-65[»]
3RL7X-ray2.30A/B/C/D/E/F220-317[»]
3RL8X-ray2.20A/B/C/D/E315-410[»]
3W9YX-ray2.20A712-904[»]
4AMHX-ray2.30A/B315-405[»]
4G69X-ray2.00A310-407[»]
ProteinModelPortaliQ12959
SMRiQ12959
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108083, 69 interactors
CORUMiQ12959
DIPiDIP-33957N
ELMiQ12959
IntActiQ12959, 134 interactors
MINTiQ12959
STRINGi9606.ENSP00000345731

Protein family/group databases

TCDBi8.A.24.1.7 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

PTM databases

GlyConnecti1182
iPTMnetiQ12959
PhosphoSitePlusiQ12959
SwissPalmiQ12959

Polymorphism and mutation databases

BioMutaiDLG1
DMDMi223590196

Proteomic databases

EPDiQ12959
jPOSTiQ12959
MaxQBiQ12959
PaxDbiQ12959
PeptideAtlasiQ12959
PRIDEiQ12959
ProteomicsDBi59049
59050 [Q12959-2]
59051 [Q12959-3]
59052 [Q12959-4]
59053 [Q12959-5]
59054 [Q12959-6]
59055 [Q12959-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000346964; ENSP00000345731; ENSG00000075711 [Q12959-2]
ENST00000392382; ENSP00000376187; ENSG00000075711 [Q12959-3]
ENST00000419354; ENSP00000407531; ENSG00000075711 [Q12959-1]
ENST00000422288; ENSP00000413238; ENSG00000075711 [Q12959-5]
ENST00000443183; ENSP00000396658; ENSG00000075711 [Q12959-9]
ENST00000448528; ENSP00000391732; ENSG00000075711 [Q12959-1]
ENST00000450955; ENSP00000411278; ENSG00000075711 [Q12959-4]
ENST00000452595; ENSP00000398939; ENSG00000075711 [Q12959-8]
GeneIDi1739
KEGGihsa:1739
UCSCiuc003fxn.4 human [Q12959-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1739
DisGeNETi1739
EuPathDBiHostDB:ENSG00000075711.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DLG1
HGNCiHGNC:2900 DLG1
HPAiCAB016307
HPA069593
MalaCardsiDLG1
MIMi601014 gene
neXtProtiNX_Q12959
OpenTargetsiENSG00000075711
Orphaneti199306 Cleft lip/palate
PharmGKBiPA27356

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000159409
HOGENOMiHOG000232102
HOVERGENiHBG107814
InParanoidiQ12959
KOiK12076
OMAiVDNHISP
OrthoDBi807583at2759
PhylomeDBiQ12959
TreeFamiTF323171

Enzyme and pathway databases

ReactomeiR-HSA-399719 Trafficking of AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-8849932 Synaptic adhesion-like molecules
R-HSA-9617324 Negative regulation of NMDA receptor-mediated neuronal transmission
R-HSA-9620244 Long-term potentiation
SIGNORiQ12959

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DLG1 human
EvolutionaryTraceiQ12959

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DLG1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1739

Protein Ontology

More...
PROi
PR:Q12959

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000075711 Expressed in 232 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ12959 baseline and differential
GenevisibleiQ12959 HS

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLG1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12959
Secondary accession number(s): A5YKK7
, B4DGU1, B4DGZ8, B7ZMM0, B9EIQ5, D3DXB8, D3DXB9, E7EWL7, E9PG21, Q12958
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 10, 2009
Last modified: February 13, 2019
This is version 217 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again