Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q12933 (TRAF2_HUMAN)

Entry version 242 (07 Apr 2021)
Sequence version 2 (19 Sep 2002)
Previous versions | rss
Add a publicationFeedback
Protein

TNF receptor-associated factor 2

Gene

TRAF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates activation of NF-kappa-B and JNK and plays a central role in the regulation of cell survival and apoptosis. Required for normal antibody isotype switching from IgM to IgG. Has E3 ubiquitin-protein ligase activity and promotes 'Lys-63'-linked ubiquitination of target proteins, such as BIRC3, RIPK1 and TICAM1. Is an essential constituent of several E3 ubiquitin-protein ligase complexes, where it promotes the ubiquitination of target proteins by bringing them into contact with other E3 ubiquitin ligases. Regulates BIRC2 and BIRC3 protein levels by inhibiting their autoubiquitination and subsequent degradation; this does not depend on the TRAF2 RING-type zinc finger domain. Plays a role in mediating activation of NF-kappa-B by EIF2AK2/PKR. In complex with BIRC2 or BIRC3, promotes ubiquitination of IKBKE.17 Publications

Caution

Was reported to interact with IL15RA (PubMed:10463949). However, this work was later retracted (PubMed:21357251).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Has very low E3 ubiquitin ligase activity in the absence of sphingosine-1-phosphate. E3 ubiquitin ligase activity is strongly activated by cytoplasmic sphingosine-1-phosphate.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri34 – 73RING-typePROSITE-ProRule annotationAdd BLAST40
Zinc fingeri124 – 180TRAF-type 1PROSITE-ProRule annotationAdd BLAST57
Zinc fingeri177 – 233TRAF-type 2PROSITE-ProRule annotationAdd BLAST57

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processApoptosis, Ubl conjugation pathway
LigandLipid-binding, Metal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q12933

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-140534, Caspase activation via Death Receptors in the presence of ligand
R-HSA-3371378, Regulation by c-FLIP
R-HSA-5213460, RIPK1-mediated regulated necrosis
R-HSA-5218900, CASP8 activity is inhibited
R-HSA-5357786, TNFR1-induced proapoptotic signaling
R-HSA-5357905, Regulation of TNFR1 signaling
R-HSA-5357956, TNFR1-induced NFkappaB signaling pathway
R-HSA-5668541, TNFR2 non-canonical NF-kB pathway
R-HSA-5675482, Regulation of necroptotic cell death
R-HSA-5676594, TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
R-HSA-5689880, Ub-specific processing proteases
R-HSA-69416, Dimerization of procaspase-8
R-HSA-75893, TNF signaling
R-HSA-933541, TRAF6 mediated IRF7 activation
R-HSA-933542, TRAF6 mediated NF-kB activation
R-HSA-9693928, Defective RIPK1-mediated regulated necrosis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q12933

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q12933

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TNF receptor-associated factor 2 (EC:2.3.2.27)
Alternative name(s):
E3 ubiquitin-protein ligase TRAF2
RING-type E3 ubiquitin transferase TRAF2Curated
Tumor necrosis factor type 2 receptor-associated protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRAF2
Synonyms:TRAP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12032, TRAF2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601895, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q12933

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000127191.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi11S → A: Reduces global phosphorylation. Partial reduction of TNF-dependent activation of NF-kappa-B and activation of JNK. 1 Publication1
Mutagenesisi11S → D: Slight increase of TNF-dependent activation of NF-kappa-B and activation of JNK. 1 Publication1
Mutagenesisi31K → R: Abolishes 'Lys-63'-linked polyubiquitination. 1
Mutagenesisi117T → A: Loss of phosphorylation site. Abolishes activation of NF-kappa-B. 1 Publication1
Mutagenesisi285I → A: Strongly reduced interaction with BIRC3. 1 Publication1
Mutagenesisi288V → A: Strongly reduced interaction with BIRC3. 1 Publication1
Mutagenesisi292E → A: Strongly reduced interaction with BIRC3. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		7186

Open Targets

More...OpenTargetsi		ENSG00000127191

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164742666

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q12933, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TRAF2

Domain mapping of disease mutations (DMDM)

More...DMDMi		23503103

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000563992 – 501TNF receptor-associated factor 2Add BLAST500

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei5PhosphoserineCombined sources1
Modified residuei7PhosphothreonineCombined sources1
Modified residuei11PhosphoserineCombined sources1 Publication1
Modified residuei22PhosphothreonineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki31Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei117Phosphothreonine; by PKC1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at several serine residues within the first 128 amino acid residues. Phosphorylated at Thr-117 in response to signaling via TNF and TNFRSF1A. Phosphorylation at Thr-117 is required for 'Lys-63'-linked polyubiquitination, but not for 'Lys-48'-linked polyubiquitination. Phosphorylation at Thr-117 is important for interaction with IKKA and IKKB, activation of IKK and subsequent activation of NF-kappa-B.1 Publication
Undergoes both 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination. Polyubiquitinated via 'Lys-63'-linked ubiquitin in response to TNF signaling; this requires prior phosphorylation at Thr-117. 'Lys-63'-linked polyubiquitination promotes TRAF2-mediated activation of NF-kappa-B. Can be polyubiquitinated at several Lys residues via 'Lys-48'-linked ubiquitin chains in response to TNF signaling, leading to proteasomal degradation. Autoubiquitinated, leading to its subsequent proteasomal degradation. Polyubiquitinated by BIRC2 and SIAH2, leading to its subsequent proteasomal degradation. Deubiquitinated by CYLD, a protease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Ubiquination is inhibited by LRRC19; inhibits proteasomal degradation (PubMed:25026888).2 Publications

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q12933

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q12933

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q12933

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q12933

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q12933

PeptideAtlas

More...PeptideAtlasi		Q12933

PRoteomics IDEntifications database

More...PRIDEi		Q12933

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		59035 [Q12933-1]
59036 [Q12933-2]
59037 [Q12933-3]
59038 [Q12933-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q12933

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q12933

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q12933

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000127191, Expressed in cerebellar hemisphere and 173 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q12933, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q12933, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000127191, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer (PubMed:8069916). Heterotrimer with TRAF1 (PubMed:8069916). Heterotrimer with TRAF3 (via TRAF domain) (PubMed:15383523, PubMed:20447407). The domain containing the RING-type and the first TRAF-type zinc finger can also form homodimers (in vitro) (PubMed:19810754).

Interacts with TNFRSF1B/TNFR2 (PubMed:7639698, PubMed:8069916, PubMed:10206649).

Interacts with TNFRSF5/CD40 (PubMed:9718306).

Interacts with TNFRSF4, TNFRSF7/CD27, TNFRSF8/CD30, TNFRSF9/CD137, TNFRSF11A/RANK, TNFRSF13B/TACI, TNFRSF14, TNFRSF16/NGFR, TNFRSF17/BCMA, TNFRSF18/AITR, TNFRSF19/TROY, TNFRSF19L/RELT and EDAR (PubMed:8627180, PubMed:9153189, PubMed:9692890, PubMed:9488716, PubMed:9774460, PubMed:9607925, PubMed:9418902, PubMed:10037686, PubMed:10514511, PubMed:10809768, PubMed:10880535, PubMed:11035039, PubMed:10411888). Stimulation of TNF-alpha receptor TNFRSF1A leads to the formation of two distinct signaling complexes. Plasma membrane-bound complex I is composed of TNFRSF1A, TRADD, RIPK1, TRAF2 and BIRC2/c-IAP1 or BIRC3 which interacts with CHUCK/IKK-alpha, IKBKB/IKK-beta and IKBKG/IKK-gamma promoting cell survival (PubMed:21307340, PubMed:18981220). Subsequently, TRADD, RIPK1 and TRAF2 dissociate from TNFRSF1A and form cytoplasmic complex II with FADD and caspase CASP8 promoting cell apoptosis (PubMed:21307340).

Interacts with TRADD (PubMed:10892748).

Identified in a complex with TNFRSF1A, RIPK1 and IKBKB/IKK-beta (PubMed:18981220).

Interacts with RIPK2 (PubMed:9705938).

Interacts with BIRC2 and BIRC3 N-terminus; a single BIRC2 or BIRC3 molecule interacts with a heterotrimer formed by TRAF1 and TRAF2, or a TRAF2 homotrimer (PubMed:11907583, PubMed:19506082, PubMed:20447407, PubMed:20385093).

Identified in a complex composed of TRAF2, TRAF3, BIRC2 and BIRC3 (By similarity).

Interacts with BIRC2; the interaction promotes BIRC2 stability (PubMed:19506082). Interaction with BIRC2 and/or BIRC3 is essential for ubiquitination of IKBKE, degradation of NFKBIA and activation of NF-kappa-B (By similarity). Within complex I, phosphorylated TRAF2 interacts (via 'Lys-63'-linked polyubiquitin chains) with CHUCK/IKK-alpha, IKBKB/IKK-beta, IKBKG/IKK-gamma TAB2, TAB3 and TAK1 in response to TNF-alpha stimulation (PubMed:19150425). Within complex I, interacts with UXT isoform 1 (via TPQE motif); the interaction prevents the recruitment of FADD and CASP8/caspase 8 to complex I (PubMed:21307340).

Forms a complex composed of TNFRSF8/CD30 or TNFRSF1B/TNFR2, and TRAF1, TRAF2 and E3 ligase TRAIP (PubMed:9104814). Within the complex, interacts with TRAIP; the interaction inhibits TRAF2-mediated NF-kappa B activation (PubMed:9104814).

Component of a complex composed of TANK and TBK1 (PubMed:10581243).

Interacts with TRPC4AP (By similarity).

Interacts with MAP3K1/MEKK1, MAP3K5/ASK1 and MAP3K11/MLK3 in response to TNF-alpha stimulation; the interaction leads to JNK activation (PubMed:10346818, PubMed:19918265, PubMed:9774977).

Component of a complex composed of MAP3K14/NIK BIRC3 and TRAF3; the interaction leads to BIRC2/3-mediated ubiquitination of TRAF3 upon CD40 engagement in a TRAF2-dependent manner (By similarity).

Interacts with MAP3K14/NIK in response to TNF-alpha stimulation; the interaction leads to NF-kappa B activation (PubMed:9020361).

Interacts with PEG3; the interaction may promote TRAF2-mediated NF-kappa B activation (By similarity).

Interacts with HIVEP3; the interaction may inhibit TNF-alpha-TRAF2-mediated NF-kappa B and JNK activation (By similarity).

Interacts with TANK/ITRAF; the interaction prevents interaction between TNFRSF1B/TNFR2 and TRAF2 (PubMed:8710854).

Interacts with deubiquitinating enzyme CYLD; the interaction results in the deubiquitination and inactivation of TRAF2 (PubMed:12917691).

Interacts with SIAH2; the interaction leads to TRAF2 ubiquitination and degradation (PubMed:12411493).

Interacts with E2 conjugating enzyme UBE2N/Ubc13, E3 ligase ITCH and RNF11 in response to TNF-alpha stimulation (By similarity).

Interacts with ubiquitin-editing enzyme TNFAIP3/A20 in response to TNF-alpha stimulation; the interaction promotes TRAF2 dissociation from UBE2N/Ubc13, ITCH, RNF11 and TAX1BP1 and prevents prolonged TRAF-2 ubiquitination (By similarity).

Interacts with TAX1BP1 in response to TNF-alpha stimulation; the interaction promotes TRAF2 dissociation from UBE2N/Ubc13 and TNFAIP3/A20, and prevents prolonged TRAF-2 ubiquitination (By similarity).

Interacts (via C-terminus) with EIF2AK2/PKR (via the kinase catalytic domain) (PubMed:15121867).

Interacts with deubiquitinating enzyme USP48 (PubMed:16214042).

Interacts with PTPN2; probably involved in TNF-mediated signaling (PubMed:15696169).

Interacts with Toll-like receptor TLR4/3 adapter TICAM1/TRIF; the interaction may promote TICAM1 ubiquitination (PubMed:20047764).

Interacts with kinase/endoribonuclease ERN1/IRE1 and DAB2IP in response to ER stress; the interaction requires DAB2IP (By similarity).

Interacts with ERN1/IRE1 and TAOK3 in response to ER stress; the interaction may promote TRAF2 phosphorylation (PubMed:11278723).

Interacts (via zinc fingers) with DAB2IP (via C-terminus PER domain)in response to TNF-alpha stimulation (PubMed:15310755, PubMed:17389591).

Interacts with CASP8AP2/FLASH (By similarity).

Interacts with NFATC2IP; the interaction may repress IL-4 production in T cells (By similarity).

Interacts with kinase CDK9 (PubMed:9827693).

Interacts with sphingosine kinase 1 SPHK1 (PubMed:20577214).

Interacts with kinase TNIK (PubMed:10521462).

Interacts with TRAFD1 (By similarity).

Interacts with DNA phosphodiesterase TDP2 (PubMed:10764746).

Interacts with MAVS/IPS1 (PubMed:16153868).

Interacts with CARD14 (PubMed:21302310).

Interacts with Epstein-Barr virus LMP1/BNFL1 (PubMed:10411888).

Interacts with GPS2 (By similarity).

Interacts with XPNPEP3 (PubMed:25609706).

Interacts with RIPK3 (PubMed:29883609).

Interacts with RELL2 (PubMed:19969290).

Interacts with LRRC19 (PubMed:25026888).

By similarity54 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q12933
With#Exp.IntAct
AASDHPPT [Q9NRN7]7EBI-355744,EBI-740884
AFF4 [Q9UHB7]3EBI-355744,EBI-395282
AFF4 - isoform 2 [Q9UHB7-2]3EBI-355744,EBI-10261324
AGR2 [O95994]3EBI-355744,EBI-712648
AKR1B15 - isoform 2 [C9JRZ8-2]3EBI-355744,EBI-17190479
AMOTL2 - isoform 4 [Q9Y2J4-4]3EBI-355744,EBI-10187270
ANKRD11 [X5D778]4EBI-355744,EBI-17183751
ANKRD36BP1 [Q96IX9]4EBI-355744,EBI-744859
APPL1 [Q9UKG1]3EBI-355744,EBI-741243
AQP1 [P29972]3EBI-355744,EBI-745213
ARHGEF6 [Q15052]3EBI-355744,EBI-1642523
ARSJ [Q8N5N6]3EBI-355744,EBI-10266832
ASCC1 [Q8N9N2]3EBI-355744,EBI-10268317
ASCC1 - isoform 2 [Q8N9N2-2]3EBI-355744,EBI-10962548
ATXN1 [P54253]14EBI-355744,EBI-930964
AXIN1 [O15169]3EBI-355744,EBI-710484
BAHD1 [Q8TBE0]4EBI-355744,EBI-742750
BANP [B4DE54]3EBI-355744,EBI-16429313
BANP [Q8N9N5]4EBI-355744,EBI-744695
BANP - isoform 2 [Q8N9N5-2]3EBI-355744,EBI-11524452
BANP - isoform 7 [Q8N9N5-7]3EBI-355744,EBI-16429296
BAZ2B [A0A0A0MR97]3EBI-355744,EBI-11985607
BCL10 [O95999]9EBI-355744,EBI-958922
BCL6 [P41182]3EBI-355744,EBI-765407
BEX2 [Q9BXY8]6EBI-355744,EBI-745073
BIRC2 [Q13490]17EBI-355744,EBI-514538
BIRC3 [Q13489]7EBI-355744,EBI-517709
BOD1L2 [Q8IYS8]3EBI-355744,EBI-12118438
BYSL [Q13895]3EBI-355744,EBI-358049
C22orf15 - isoform 2 [Q8WYQ4-2]3EBI-355744,EBI-12030460
C2CD6 [Q53TS8]3EBI-355744,EBI-739879
CAPN15 [O75808]3EBI-355744,EBI-6149008
CATSPER1 [Q8NEC5]3EBI-355744,EBI-744545
CBX8 [Q9HC52]6EBI-355744,EBI-712912
CCDC198 [E9PSE9]3EBI-355744,EBI-11748295
CCDC198 [Q9NVL8]3EBI-355744,EBI-10238351
CCHCR1 - isoform 3 [Q8TD31-3]8EBI-355744,EBI-10175300
CCNJL [F6RF56]3EBI-355744,EBI-10177725
CD40 [P25942]15EBI-355744,EBI-525714
CDC20B [Q86Y33]3EBI-355744,EBI-10260504
CDC20B - isoform 5 [Q86Y33-5]3EBI-355744,EBI-11983537
CDC37 [Q16543]3EBI-355744,EBI-295634
CDCA3 [Q99618]7EBI-355744,EBI-739534
CDK18 [Q07002]3EBI-355744,EBI-746238
CDKN1B [P46527]6EBI-355744,EBI-519280
CEP57L1 - isoform 2 [Q8IYX8-2]3EBI-355744,EBI-10181988
CHCHD2 [Q9Y6H1]3EBI-355744,EBI-2321769
CLCNKA - isoform 3 [P51800-3]3EBI-355744,EBI-11980535
CREB5 - isoform 3 [Q02930-3]6EBI-355744,EBI-10192698
CRY2 [Q49AN0]3EBI-355744,EBI-2212355
CRYBA2 [P53672]3EBI-355744,EBI-750444
CTCF [P49711]3EBI-355744,EBI-932887
CWF19L2 [Q2TBE0]3EBI-355744,EBI-5453285
CYB5R2 [Q6BCY4]3EBI-355744,EBI-744761
CYB5R2 - isoform 2 [Q6BCY4-2]3EBI-355744,EBI-12102608
DDI1 [Q8WTU0]3EBI-355744,EBI-748248
DDX6 [P26196]3EBI-355744,EBI-351257
DMTN [Q08495]3EBI-355744,EBI-715275
DTNB [O60941]5EBI-355744,EBI-740402
DTNB - isoform 5 [O60941-5]3EBI-355744,EBI-11984733
DVL3 [Q92997]3EBI-355744,EBI-739789
EAF1 [Q96JC9]3EBI-355744,EBI-769261
EBF2 [Q9HAK2]3EBI-355744,EBI-12267154
EDARADD [Q8WWZ3]5EBI-355744,EBI-2949647
EEF1AKNMT [Q8N6R0]3EBI-355744,EBI-1053295
EFEMP1 [A0A0S2Z3V1]3EBI-355744,EBI-16434097
EFEMP1 [Q12805]12EBI-355744,EBI-536772
EFHC1 [Q5JVL4]6EBI-355744,EBI-743105
EGFR [P00533]4EBI-355744,EBI-297353
EHHADH [Q08426]3EBI-355744,EBI-2339219
ENKD1 [Q9H0I2]7EBI-355744,EBI-744099
EP400 [A0A0A0MR80]3EBI-355744,EBI-12089140
ERN1 [O75460]3EBI-355744,EBI-371750
ETV6 [A0A0S2Z3N6]3EBI-355744,EBI-16434659
EWSR1 [Q01844]3EBI-355744,EBI-739737
EXOC3-AS1 [Q8N2X6]4EBI-355744,EBI-749333
FAM107A - isoform 4 [O95990-4]3EBI-355744,EBI-11977223
FAM120B [Q96EK7]4EBI-355744,EBI-739883
FAM124B - isoform 2 [Q9H5Z6-2]3EBI-355744,EBI-11986315
FAM161A [Q3B820]3EBI-355744,EBI-719941
FAM161B [Q96MY7]3EBI-355744,EBI-7225287
FAM214B [Q7L5A3]3EBI-355744,EBI-745689
FAM50B [Q9Y247]3EBI-355744,EBI-742802
FAM90A1 [Q86YD7]6EBI-355744,EBI-6658203
FAM9A [Q8IZU1]3EBI-355744,EBI-8468186
FARS2 [O95363]3EBI-355744,EBI-2513774
FBXO28 [Q9NVF7]7EBI-355744,EBI-740282
FDXACB1 [Q9BRP7]6EBI-355744,EBI-10297077
FLYWCH1 [Q4VC44]3EBI-355744,EBI-719415
FNDC3B - isoform 3 [Q53EP0-3]3EBI-355744,EBI-10242151
FOXN1 [O15353]3EBI-355744,EBI-11319000
GABPB1 [Q06547]7EBI-355744,EBI-618165
GAS2L2 [Q8NHY3]3EBI-355744,EBI-7960826
GAS8 [O95995]3EBI-355744,EBI-1052570
GCA [P28676]3EBI-355744,EBI-947242
GEM [P55040]3EBI-355744,EBI-744104
GORASP2 [Q9H8Y8]8EBI-355744,EBI-739467
GPANK1 [O95872]3EBI-355744,EBI-751540
GPKOW [Q92917]7EBI-355744,EBI-746309
GRIPAP1 [Q4V328]3EBI-355744,EBI-717919
GSE1 [Q14687]3EBI-355744,EBI-372619
GSG1 [Q2KHT4]3EBI-355744,EBI-10239244
GSTP1 [P09211]5EBI-355744,EBI-353467
GSTZ1 [O43708]3EBI-355744,EBI-748043
HBM [Q6B0K9]3EBI-355744,EBI-12805802
hCG_1987119 [A0A024R8L2]3EBI-355744,EBI-14103818
HENMT1 [Q5T8I9]3EBI-355744,EBI-9675710
HOXA1 [P49639]3EBI-355744,EBI-740785
HOXB5 [P09067]3EBI-355744,EBI-3893317
HSPA12B [Q96MM6]3EBI-355744,EBI-10291310
HTT [P42858]3EBI-355744,EBI-466029
IMPDH2 [P12268]3EBI-355744,EBI-353389
INO80B [Q9C086]3EBI-355744,EBI-715611
IP6K3 [Q96PC2]3EBI-355744,EBI-10990676
IQUB [Q8NA54]3EBI-355744,EBI-10220600
ITPRIPL1 - isoform 2 [Q6GPH6-2]3EBI-355744,EBI-12337095
KANK2 [Q63ZY3]3EBI-355744,EBI-2556193
KIAA1217 - isoform 6 [Q5T5P2-6]3EBI-355744,EBI-10188326
KIFC3 [Q9BVG8]3EBI-355744,EBI-2125614
KIFC3 - isoform 4 [Q9BVG8-5]3EBI-355744,EBI-14069005
KLF3 [P57682]6EBI-355744,EBI-8472267
LENG1 [Q96BZ8]3EBI-355744,EBI-726510
LINC02875 [Q86X59]3EBI-355744,EBI-8465536
LMNTD2 [Q8IXW0]3EBI-355744,EBI-12028858
LNX1 [Q8TBB1]5EBI-355744,EBI-739832
LONRF1 [Q17RB8]3EBI-355744,EBI-2341787
LONRF3 [Q496Y0]3EBI-355744,EBI-2690768
LYSMD1 [Q96S90]3EBI-355744,EBI-10293291
MACROH2A1 [O75367]3EBI-355744,EBI-2868511
MAP3K14 [Q99558]9EBI-355744,EBI-358011
MAP3K5 [Q99683]4EBI-355744,EBI-476263
MAVS [Q7Z434]5EBI-355744,EBI-995373
MFAP1 [P55081]3EBI-355744,EBI-1048159
MGC50722 [Q8IVT4]3EBI-355744,EBI-14086479
MISP [Q8IVT2]3EBI-355744,EBI-2555085
MKRN3 [Q13064]3EBI-355744,EBI-2340269
MORF4L1 - isoform 2 [Q9UBU8-2]3EBI-355744,EBI-10288852
MORN3 [Q6PF18]6EBI-355744,EBI-9675802
MOS [P00540]3EBI-355744,EBI-1757866
MPP5 [Q8N3R9]3EBI-355744,EBI-2513978
MSRB2 [Q9Y3D2]3EBI-355744,EBI-9092052
NAB2 [Q15742]3EBI-355744,EBI-8641936
NATD1 [Q8N6N6]3EBI-355744,EBI-8656665
NEBL [O76041]7EBI-355744,EBI-2880203
NEDD9 - isoform 2 [Q14511-2]3EBI-355744,EBI-11746523
NEK6 - isoform 4 [Q9HC98-4]3EBI-355744,EBI-11750983
NFIL3 [Q16649]3EBI-355744,EBI-3951858
NFKBID [Q8NI38]3EBI-355744,EBI-10271199
NHSL2 [Q5HYW2]3EBI-355744,EBI-2859639
NMUR2 [Q9GZQ4]3EBI-355744,EBI-10303844
NOXA1 - isoform 2 [Q86UR1-2]3EBI-355744,EBI-12025760
NRF1 [Q16656]3EBI-355744,EBI-2547810
NRF1 - isoform 4 [Q16656-4]3EBI-355744,EBI-11742836
NSMF - isoform 2 [Q6X4W1-2]3EBI-355744,EBI-12028784
NUDT16L1 [Q9BRJ7]6EBI-355744,EBI-2949792
PATZ1 - isoform 4 [Q9HBE1-4]3EBI-355744,EBI-11022007
PCGF2 [P35227]3EBI-355744,EBI-2129767
PCGF5 [Q86SE9]3EBI-355744,EBI-2827999
PDZD4 [Q17RL8]3EBI-355744,EBI-10239064
PGBD1 [Q96JS3]7EBI-355744,EBI-10290053
PIAS2 - isoform PIAS2-alpha [O75928-2]3EBI-355744,EBI-348567
PIBF1 [Q4G0R1]3EBI-355744,EBI-14066006
PIN1 [Q13526]7EBI-355744,EBI-714158
PKN1 [Q16512]3EBI-355744,EBI-602382
POLR3C [Q9BUI4]3EBI-355744,EBI-5452779
POM121 - isoform 2 [Q96HA1-2]3EBI-355744,EBI-11956563
PPL [O60437]6EBI-355744,EBI-368321
PPP1R18 [Q6NYC8]3EBI-355744,EBI-2557469
PPP1R26 [Q5T8A7]3EBI-355744,EBI-308500
PPP1R32 - isoform 2 [Q7Z5V6-2]3EBI-355744,EBI-12000762
PRKAB2 [O43741]8EBI-355744,EBI-1053424
PRKRIP1 [Q9H875]3EBI-355744,EBI-744488
PRPF18 [Q99633]3EBI-355744,EBI-2798416
PSMB1 [P20618]5EBI-355744,EBI-372273
PSMD9 [O00233]3EBI-355744,EBI-750973
PSME3IP1 [Q9GZU8]3EBI-355744,EBI-2371956
QARS1 [P47897]3EBI-355744,EBI-347462
QRICH1 [Q2TAL8]3EBI-355744,EBI-2798044
RAD23A [P54725]8EBI-355744,EBI-746453
RAD54L2 [Q9Y4B4]3EBI-355744,EBI-948156
RASSF5 [Q8WWW0]3EBI-355744,EBI-367390
RBM41 [Q96IZ5]6EBI-355744,EBI-740773
RCOR3 [Q9P2K3]4EBI-355744,EBI-743428
RFX3 [P48380]5EBI-355744,EBI-742557
RIN1 [Q13671]3EBI-355744,EBI-366017
RIPK1 [Q13546]8EBI-355744,EBI-358507
RIPPLY1 [Q0D2K3]6EBI-355744,EBI-10226430
RIPPLY3 [P57055]3EBI-355744,EBI-12092053
RNF146 [Q9NTX7]3EBI-355744,EBI-722397
RNF146 - isoform 2 [Q9NTX7-2]3EBI-355744,EBI-11750630
RNF4 [P78317]3EBI-355744,EBI-2340927
RSPH14 [Q9UHP6]3EBI-355744,EBI-748350
SAMD11 [Q96NU1]3EBI-355744,EBI-14067109
SCNM1 [Q9BWG6]3EBI-355744,EBI-748391
SH2D4A [Q9H788]3EBI-355744,EBI-747035
SHC3 [Q92529]3EBI-355744,EBI-79084
SLC4A3 [P48751]3EBI-355744,EBI-20805570
SMG9 [Q9H0W8]6EBI-355744,EBI-2872322
SNAI1 [O95863]3EBI-355744,EBI-1045459
SNRNP25 [Q9BV90]3EBI-355744,EBI-9675976
SOX13 [Q9UN79]3EBI-355744,EBI-3928516
SOX3 [P41225]3EBI-355744,EBI-9078386
SOX5 - isoform 4 [P35711-4]3EBI-355744,EBI-11954419
SPG21 [Q9NZD8]8EBI-355744,EBI-742688
SUMO1 [P63165]3EBI-355744,EBI-80140
SUMO1P1 [G2XKQ0]3EBI-355744,EBI-10175576
SYT17 [Q9BSW7]6EBI-355744,EBI-745392
SYT6 - isoform 2 [Q5T7P8-2]3EBI-355744,EBI-10246152
TANK [Q92844]8EBI-355744,EBI-356349
TAOK3 [Q9H2K8]2EBI-355744,EBI-1384100
TBK1 [Q9UHD2]6EBI-355744,EBI-356402
TCAF1 - isoform 2 [Q9Y4C2-2]3EBI-355744,EBI-11974855
TCAP [O15273]3EBI-355744,EBI-954089
TCEA2 [Q15560]7EBI-355744,EBI-710310
TCEANC - isoform 2 [Q8N8B7-2]3EBI-355744,EBI-11955057
TCL1A [P56279]3EBI-355744,EBI-749995
TEKT3 [Q9BXF9]6EBI-355744,EBI-8644516
THAP7 [Q9BT49]13EBI-355744,EBI-741350
THOP1 [Q96CV8]3EBI-355744,EBI-6137619
TIFA [Q96CG3]12EBI-355744,EBI-740711
TIGD4 [Q8IY51]3EBI-355744,EBI-12117432
TLE5 [Q08117]3EBI-355744,EBI-717810
TNFAIP3 [P21580]10EBI-355744,EBI-527670
TNFRSF11A [Q9Y6Q6]2EBI-355744,EBI-525675
TNFRSF11A - isoform 2 [Q9Y6Q6-2]5EBI-355744,EBI-20899422
TNFRSF12A [Q9NP84]3EBI-355744,EBI-2851995
TNFRSF14 [Q92956]2EBI-355744,EBI-1056653
TNFRSF1B [P20333]3EBI-355744,EBI-358983
TNIK [Q9UKE5]2EBI-355744,EBI-1051794
TRADD [Q15628]13EBI-355744,EBI-359215
TRAF1 [Q13077]11EBI-355744,EBI-359224
itself11EBI-355744,EBI-355744
TRAF5 [O00463]5EBI-355744,EBI-523498
TRAF6 [Q9Y4K3]9EBI-355744,EBI-359276
TRIM14 [Q14142]3EBI-355744,EBI-2820256
TRIM42 [Q8IWZ5]3EBI-355744,EBI-5235829
TRIM50 [Q86XT4]3EBI-355744,EBI-9867283
TROAP [Q12815]5EBI-355744,EBI-2349743
TRPT1 - isoform 2 [Q86TN4-2]3EBI-355744,EBI-12403619
TSGA10IP [Q3SY00]3EBI-355744,EBI-10241197
TSHZ2 [Q9NRE2]3EBI-355744,EBI-10687282
TSHZ3 [Q63HK5]3EBI-355744,EBI-9053916
TSSC4 [Q9Y5U2]3EBI-355744,EBI-717229
TTC23 - isoform 3 [Q5W5X9-3]3EBI-355744,EBI-9090990
TXN [P10599]3EBI-355744,EBI-594644
UBE2I [Q7KZS0]3EBI-355744,EBI-10180829
UBXN11 [Q5T124]5EBI-355744,EBI-746004
UBXN11 - isoform 6 [Q5T124-6]3EBI-355744,EBI-11524408
USF1 [P22415]3EBI-355744,EBI-1054489
USP2 [O75604]7EBI-355744,EBI-743272
UTP14C [Q5TAP6]3EBI-355744,EBI-11737646
UTP23 [Q9BRU9]3EBI-355744,EBI-5457544
VEZF1 [Q14119]3EBI-355744,EBI-11980193
VWA2 [Q5GFL6]3EBI-355744,EBI-10243723
WASF1 [Q92558]3EBI-355744,EBI-1548747
YES1 [P07947]6EBI-355744,EBI-515331
ZBTB16 [Q05516]5EBI-355744,EBI-711925
ZBTB24 [O43167]3EBI-355744,EBI-744471
ZBTB25 [P24278]4EBI-355744,EBI-739899
ZBTB49 [Q6ZSB9]3EBI-355744,EBI-2859943
ZC2HC1C [Q53FD0]3EBI-355744,EBI-740767
ZC2HC1C - isoform 2 [Q53FD0-2]3EBI-355744,EBI-14104088
ZFAND6 [Q6FIF0]7EBI-355744,EBI-724630
ZKSCAN3 [Q9BRR0]3EBI-355744,EBI-1965777
ZMAT2 [Q96NC0]6EBI-355744,EBI-2682299
ZMYM5 - isoform 2 [Q9UJ78-2]3EBI-355744,EBI-17634549
ZNF250 - isoform 3 [P15622-3]3EBI-355744,EBI-10177272
ZNF35 [P13682]3EBI-355744,EBI-11041653
ZNF410 [Q86VK4]3EBI-355744,EBI-720304
ZNF410 - isoform 3 [Q86VK4-3]3EBI-355744,EBI-11741890
ZNF417 [Q8TAU3]3EBI-355744,EBI-740727
ZNF438 [Q7Z4V0]3EBI-355744,EBI-11962468
ZNF488 [Q96MN9]3EBI-355744,EBI-948288
ZNF509 [Q32MK9]3EBI-355744,EBI-10239929
ZNF544 [Q6NX49]4EBI-355744,EBI-2841978
ZNF572 [Q7Z3I7]3EBI-355744,EBI-10172590
ZNF574 - isoform 2 [Q6ZN55-2]3EBI-355744,EBI-17189720
ZNF648 [Q5T619]3EBI-355744,EBI-11985915
ZNF655 [Q8N720]3EBI-355744,EBI-625509
ZNF662 - isoform 3 [Q6ZS27-3]3EBI-355744,EBI-10255155
ZNF688 [A0A0S2Z6P0]3EBI-355744,EBI-16429989
ZNF774 [Q6NX45]3EBI-355744,EBI-10251462
ZSCAN23 [Q3MJ62]6EBI-355744,EBI-5667532
ZSCAN32 [Q9NX65]3EBI-355744,EBI-739949
ZSWIM3 [Q96MP5]3EBI-355744,EBI-5235554
ZZZ3 [Q8IYH5]3EBI-355744,EBI-2795524
A0A384ME253EBI-355744,EBI-10211777
B2R8Y43EBI-355744,EBI-10175581
Casp12 [O08736] from Mus musculus.6EBI-355744,EBI-6140033
Hoxa1 [P09022] from Mus musculus.3EBI-355744,EBI-3957603
Map3k1 [Q62925] from Rattus norvegicus.2EBI-355744,EBI-636664
Ngfr [P07174] from Rattus norvegicus.3EBI-355744,EBI-1038810
NSP1 [P89055] from Rotavirus sp..3EBI-355744,EBI-9522973
Traf5 [P70191] from Mus musculus.2EBI-355744,EBI-523899
P88961 from Human herpesvirus 8 type M.3EBI-355744,EBI-7907665
Isoform 2 [Q12933-2]
With#Exp.IntAct
TNFRSF14 [Q92956]4EBI-355760,EBI-1056653

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113038, 546 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q12933

Database of interacting proteins

More...DIPi		DIP-6223N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q12933

Protein interaction database and analysis system

More...IntActi		Q12933, 440 interactors

Molecular INTeraction database

More...MINTi		Q12933

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000247668

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q12933, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1501
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q12933

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q12933

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini351 – 496MATHPROSITE-ProRule annotationAdd BLAST146

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni283 – 293Important for interaction with BIRC2 and BIRC3By similarityAdd BLAST11

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili299 – 3481 PublicationAdd BLAST50

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil domain mediates homo- and hetero-oligomerization.1 Publication
The MATH/TRAF domain binds to receptor cytoplasmic domains.1 Publication
The RING-type zinc finger domain is essential for E3 ubiquitin-protein ligase activity. It is not essential for the stabilization of BIRC2, or for the ubiquitination of RIPK1 in response to TNFR1 signaling.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TNF receptor-associated factor family. A subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri34 – 73RING-typePROSITE-ProRule annotationAdd BLAST40
Zinc fingeri124 – 180TRAF-type 1PROSITE-ProRule annotationAdd BLAST57
Zinc fingeri177 – 233TRAF-type 2PROSITE-ProRule annotationAdd BLAST57

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0297, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156621

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021061_4_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q12933

Identification of Orthologs from Complete Genome Data

More...OMAi		CRFHAVG

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q12933

TreeFam database of animal gene trees

More...TreeFami		TF321154

Family and domain databases

Conserved Domains Database

More...CDDi		cd03778, MATH_TRAF2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.210.10, 1 hit
3.30.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002083, MATH/TRAF_dom
IPR043211, TNF_rcpt-assoc_TRAF
IPR012227, TNF_rcpt-assoc_TRAF_met
IPR008974, TRAF-like
IPR027133, TRAF2
IPR037305, TRAF2_MATH
IPR032070, TRAF_BIRC3-bd
IPR018957, Znf_C3HC4_RING-type
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS
IPR001293, Znf_TRAF

The PANTHER Classification System

More...PANTHERi		PTHR10131, PTHR10131, 1 hit
PTHR10131:SF21, PTHR10131:SF21, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16673, TRAF_BIRC3_bd, 1 hit
PF00097, zf-C3HC4, 1 hit
PF02176, zf-TRAF, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF015614, TRAF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00061, MATH, 1 hit
SM00184, RING, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49599, SSF49599, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50144, MATH, 1 hit
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit
PS50145, ZF_TRAF, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12933-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAASVTPPG SLELLQPGFS KTLLGTKLEA KYLCSACRNV LRRPFQAQCG 
        60         70         80         90        100
HRYCSFCLAS ILSSGPQNCA ACVHEGIYEE GISILESSSA FPDNAARREV 
       110        120        130        140        150
ESLPAVCPSD GCTWKGTLKE YESCHEGRCP LMLTECPACK GLVRLGEKER 
       160        170        180        190        200
HLEHECPERS LSCRHCRAPC CGADVKAHHE VCPKFPLTCD GCGKKKIPRE 
       210        220        230        240        250
KFQDHVKTCG KCRVPCRFHA IGCLETVEGE KQQEHEVQWL REHLAMLLSS 
       260        270        280        290        300
VLEAKPLLGD QSHAGSELLQ RCESLEKKTA TFENIVCVLN REVERVAMTA 
       310        320        330        340        350
EACSRQHRLD QDKIEALSSK VQQLERSIGL KDLAMADLEQ KVLEMEASTY 
       360        370        380        390        400
DGVFIWKISD FARKRQEAVA GRIPAIFSPA FYTSRYGYKM CLRIYLNGDG 
       410        420        430        440        450
TGRGTHLSLF FVVMKGPNDA LLRWPFNQKV TLMLLDQNNR EHVIDAFRPD 
       460        470        480        490        500
VTSSSFQRPV NDMNIASGCP LFCPVSKMEA KNSYVRDDAI FIKAIVDLTG 

L
Length:501
Mass (Da):55,859
Last modified:September 19, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC508BE185B783B20
GO
Isoform 2 (identifier: Q12933-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-122: E → EVKMPACGMVTEAPAVGSRPRSPSSYDLVLHVPLTGAEACLMSVEEETELLLR

Show »
Length:553
Mass (Da):61,384
Checksum:iE5000CF242B2F404
GO
Isoform 3 (identifier: Q12933-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-63: Missing.

Show »
Length:490
Mass (Da):54,671
Checksum:i9CAF6DDAB0DE64DD
GO
Isoform 4 (identifier: Q12933-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-200: Missing.

Show »
Length:476
Mass (Da):53,055
Checksum:iBB290C92E8D33D79
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AMX8B1AMX8_HUMAN
TNF receptor-associated factor 2
TRAF2
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMX7B1AMX7_HUMAN
TNF receptor-associated factor 2
TRAF2
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AMY1B1AMY1_HUMAN
TNF receptor-associated factor 2
TRAF2
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti205 – 310Missing in BAB70792 (PubMed:14702039).CuratedAdd BLAST106
Sequence conflicti343 – 365LEMEA…FARKR → RPFQAQCGHRYCSFCLASIL RKL in AAA87706 (PubMed:7639698).CuratedAdd BLAST23

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03968753 – 63Missing in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_007401122E → EVKMPACGMVTEAPAVGSRP RSPSSYDLVLHVPLTGAEAC LMSVEEETELLLR in isoform 2. 1 Publication1
Alternative sequenceiVSP_039688176 – 200Missing in isoform 4. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U12597 mRNA Translation: AAA87706.1
AK054686 mRNA Translation: BAB70792.1
AK289722 mRNA Translation: BAF82411.1
AK298370 mRNA Translation: BAG60609.1
BX538160 mRNA Translation: CAD98040.1
AY623660 Genomic DNA Translation: AAT27320.1
AL355987 Genomic DNA No translation available.
AL449425 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88299.1
BC032410 mRNA Translation: AAH32410.1
BC033810 mRNA Translation: AAH33810.1
BC043492 mRNA Translation: AAH43492.1
BC064662 mRNA Translation: AAH64662.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS7013.1 [Q12933-1]

Protein sequence database of the Protein Information Resource

More...PIRi		S56163

NCBI Reference Sequences

More...RefSeqi		NP_066961.2, NM_021138.3 [Q12933-1]
XP_011517276.1, XM_011518974.2 [Q12933-1]
XP_011517277.1, XM_011518975.2
XP_011517278.1, XM_011518976.2 [Q12933-1]
XP_011517279.1, XM_011518977.2 [Q12933-1]
XP_011517280.1, XM_011518978.2
XP_016870584.1, XM_017015095.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000247668; ENSP00000247668; ENSG00000127191 [Q12933-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7186

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7186

UCSC genome browser

More...UCSCi		uc004cjv.4, human [Q12933-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U12597 mRNA Translation: AAA87706.1
AK054686 mRNA Translation: BAB70792.1
AK289722 mRNA Translation: BAF82411.1
AK298370 mRNA Translation: BAG60609.1
BX538160 mRNA Translation: CAD98040.1
AY623660 Genomic DNA Translation: AAT27320.1
AL355987 Genomic DNA No translation available.
AL449425 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88299.1
BC032410 mRNA Translation: AAH32410.1
BC033810 mRNA Translation: AAH33810.1
BC043492 mRNA Translation: AAH43492.1
BC064662 mRNA Translation: AAH64662.1
CCDSiCCDS7013.1 [Q12933-1]
PIRiS56163
RefSeqiNP_066961.2, NM_021138.3 [Q12933-1]
XP_011517276.1, XM_011518974.2 [Q12933-1]
XP_011517277.1, XM_011518975.2
XP_011517278.1, XM_011518976.2 [Q12933-1]
XP_011517279.1, XM_011518977.2 [Q12933-1]
XP_011517280.1, XM_011518978.2
XP_016870584.1, XM_017015095.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CA4X-ray2.20A/B/C/D/E/F334-501[»]
1CA9X-ray2.30A/B/C/D/E/F310-501[»]
1CZYX-ray2.00A/B/C334-501[»]
1CZZX-ray2.70A/B/C315-501[»]
1D00X-ray2.00A/B/C/D/E/F/G/H334-501[»]
1D01X-ray2.00A/B/C/D/E/F334-501[»]
1D0AX-ray2.00A/B/C/D/E/F334-501[»]
1D0JX-ray2.50A/B/C/D/E/F334-501[»]
1F3VX-ray2.00B331-501[»]
1QSCX-ray2.40A/B/C311-501[»]
3KNVX-ray1.90A1-133[»]
3M06X-ray2.67A/B/C/D/E/F266-329[»]
3M0AX-ray2.61A/B/C266-329[»]
3M0DX-ray2.80A/B266-329[»]
SMRiQ12933
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113038, 546 interactors
CORUMiQ12933
DIPiDIP-6223N
ELMiQ12933
IntActiQ12933, 440 interactors
MINTiQ12933
STRINGi9606.ENSP00000247668

PTM databases

iPTMnetiQ12933
MetOSiteiQ12933
PhosphoSitePlusiQ12933

Genetic variation databases

BioMutaiTRAF2
DMDMi23503103

Proteomic databases

EPDiQ12933
jPOSTiQ12933
MassIVEiQ12933
MaxQBiQ12933
PaxDbiQ12933
PeptideAtlasiQ12933
PRIDEiQ12933
ProteomicsDBi59035 [Q12933-1]
59036 [Q12933-2]
59037 [Q12933-3]
59038 [Q12933-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2422, 739 antibodies

The DNASU plasmid repository

More...DNASUi		7186

Genome annotation databases

EnsembliENST00000247668; ENSP00000247668; ENSG00000127191 [Q12933-1]
GeneIDi7186
KEGGihsa:7186
UCSCiuc004cjv.4, human [Q12933-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7186
DisGeNETi7186

GeneCards: human genes, protein and diseases

More...GeneCardsi		TRAF2
HGNCiHGNC:12032, TRAF2
HPAiENSG00000127191, Low tissue specificity
MIMi601895, gene
neXtProtiNX_Q12933
OpenTargetsiENSG00000127191
PharmGKBiPA164742666
VEuPathDBiHostDB:ENSG00000127191.17

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0297, Eukaryota
GeneTreeiENSGT00940000156621
HOGENOMiCLU_021061_4_1_1
InParanoidiQ12933
OMAiCRFHAVG
PhylomeDBiQ12933
TreeFamiTF321154

Enzyme and pathway databases

UniPathwayiUPA00143
PathwayCommonsiQ12933
ReactomeiR-HSA-140534, Caspase activation via Death Receptors in the presence of ligand
R-HSA-3371378, Regulation by c-FLIP
R-HSA-5213460, RIPK1-mediated regulated necrosis
R-HSA-5218900, CASP8 activity is inhibited
R-HSA-5357786, TNFR1-induced proapoptotic signaling
R-HSA-5357905, Regulation of TNFR1 signaling
R-HSA-5357956, TNFR1-induced NFkappaB signaling pathway
R-HSA-5668541, TNFR2 non-canonical NF-kB pathway
R-HSA-5675482, Regulation of necroptotic cell death
R-HSA-5676594, TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
R-HSA-5689880, Ub-specific processing proteases
R-HSA-69416, Dimerization of procaspase-8
R-HSA-75893, TNF signaling
R-HSA-933541, TRAF6 mediated IRF7 activation
R-HSA-933542, TRAF6 mediated NF-kB activation
R-HSA-9693928, Defective RIPK1-mediated regulated necrosis
SignaLinkiQ12933
SIGNORiQ12933

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7186, 153 hits in 999 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TRAF2, human
EvolutionaryTraceiQ12933

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TRAF2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7186
PharosiQ12933, Tbio

Protein Ontology

More...PROi		PR:Q12933
RNActiQ12933, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000127191, Expressed in cerebellar hemisphere and 173 other tissues
ExpressionAtlasiQ12933, baseline and differential
GenevisibleiQ12933, HS

Family and domain databases

CDDicd03778, MATH_TRAF2, 1 hit
Gene3Di2.60.210.10, 1 hit
3.30.40.10, 3 hits
InterProiView protein in InterPro
IPR002083, MATH/TRAF_dom
IPR043211, TNF_rcpt-assoc_TRAF
IPR012227, TNF_rcpt-assoc_TRAF_met
IPR008974, TRAF-like
IPR027133, TRAF2
IPR037305, TRAF2_MATH
IPR032070, TRAF_BIRC3-bd
IPR018957, Znf_C3HC4_RING-type
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS
IPR001293, Znf_TRAF
PANTHERiPTHR10131, PTHR10131, 1 hit
PTHR10131:SF21, PTHR10131:SF21, 1 hit
PfamiView protein in Pfam
PF16673, TRAF_BIRC3_bd, 1 hit
PF00097, zf-C3HC4, 1 hit
PF02176, zf-TRAF, 1 hit
PIRSFiPIRSF015614, TRAF, 1 hit
SMARTiView protein in SMART
SM00061, MATH, 1 hit
SM00184, RING, 1 hit
SUPFAMiSSF49599, SSF49599, 1 hit
PROSITEiView protein in PROSITE
PS50144, MATH, 1 hit
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit
PS50145, ZF_TRAF, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRAF2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12933
Secondary accession number(s): A8K107
, B4DPJ7, Q7Z337, Q96NT2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 19, 2002
Last modified: April 7, 2021
This is version 242 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again