UniProtKB - Q12918 (KLRB1_HUMAN)

BLAST

>sp|Q12918|KLRB1_HUMAN Killer cell lectin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=KLRB1 PE=1 SV=1
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS

Align
Format
Add to basket Added to basket
History
Entry version 127 (12 Sep 2018)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Killer cell lectin-like receptor subfamily B member 1

Gene

KLRB1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Plays an inhibitory role on natural killer (NK) cells cytotoxicity. Activation results in specific acid sphingomyelinase/SMPD1 stimulation with subsequent marked elevation of intracellular ceramide. Activation also leads to AKT1/PKB and RPS6KA1/RSK1 kinases stimulation as well as markedly enhanced T-cell proliferation induced by anti-CD3. Acts as a lectin that binds to the terminal carbohydrate Gal-alpha(1,3)Gal epitope as well as to the N-acetyllactosamine epitope. Binds also to CLEC2D/LLT1 as a ligand and inhibits NK cell-mediated cytotoxicity as well as interferon-gamma secretion in target cells.3 Publications

GO - Molecular functionⁱ

carbohydrate binding
Source: ProtInc
Traceable author statementⁱ
- 8077657
transmembrane signaling receptor activity
Source: ProtInc
Traceable author statementⁱ
- 8077657

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell surface receptor signaling pathway
Source: ProtInc
Traceable author statementⁱ
- 8077657
regulation of immune response Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Receptor
Ligand	Lectin

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Killer cell lectin-like receptor subfamily B member 1 Alternative name(s): C-type lectin domain family 5 member B HNKR-P1a Short name: NKR-P1A Natural killer cell surface protein P1A CD_antigen: CD161
Gene namesⁱ	Name:KLRB1 Synonyms:CLEC5B, NKRP1A
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 12

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000111796.3
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:6373 KLRB1
MIMⁱ	602890 gene
neXtProtⁱ	NX_Q12918

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 45	CytoplasmicSequence analysisAdd BLAST	45
Transmembraneⁱ	46 – 66	Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST	21
Topological domainⁱ	67 – 225	ExtracellularSequence analysisAdd BLAST	159

Keywords - Cellular componentⁱ

Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	3820
Open Targets More...OpenTargetsⁱ	ENSG00000111796
PharmGKBⁱ	PA30162

Polymorphism and mutation databases

BioMutaⁱ	KLRB1
DMDMⁱ	74722301

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000260000	1 – 225	Killer cell lectin-like receptor subfamily B member 1Add BLAST		225

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	94 ↔ 105	PROSITE-ProRule annotation
Disulfide bondⁱ	122 ↔ 210	PROSITE-ProRule annotation
Glycosylationⁱ	157	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	189 ↔ 202	PROSITE-ProRule annotation

Post-translational modificationⁱ

N-glycosylated. Contains sialic acid residues.1 Publication

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbⁱ	Q12918
PeptideAtlas More...PeptideAtlasⁱ	Q12918
PRIDEⁱ	Q12918
ProteomicsDBⁱ	59026

Expressionⁱ

Tissue specificityⁱ

Expressed in a subset of NK cells predominantly in intestinal epithelium and liver. Detected in peripheral blood T-cells and preferentially in adult T-cells with a memory antigenic phenotype.2 Publications

Inductionⁱ

By IL12/interleukin-12 in NK cells.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000111796 Expressed in 130 organ(s), highest expression level in mononuclear cell
CleanExⁱ	HS_KLRB1
Genevisibleⁱ	Q12918 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA039113

HPAⁱ

HPA039113

Interactionⁱ

Subunit structureⁱ

Homodimer; disulfide-linked. Interacts with acid sphingomyelinase/SMPD1.4 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
CLEC2D	Q9UHP7-1	2	EBI-2805465,EBI-13640978

With

Entry

#Exp.

IntAct

Notes

CLEC2D

Q9UHP7-1

EBI-2805465,EBI-13640978

Protein-protein interaction databases

IntActⁱ	Q12918, 2 interactors
STRINGⁱ	9606.ENSP00000229402

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	92 – 94	Combined sources	3
Beta strandⁱ	99 – 101	Combined sources	3
Beta strandⁱ	104 – 108	Combined sources	5
Helixⁱ	115 – 124	Combined sources	10
Helixⁱ	135 – 142	Combined sources	8
Beta strandⁱ	152 – 159	Combined sources	8
Turnⁱ	160 – 163	Combined sources	4
Beta strandⁱ	164 – 167	Combined sources	4
Beta strandⁱ	188 – 192	Combined sources	5
Beta strandⁱ	197 – 201	Combined sources	5
Beta strandⁱ	206 – 213	Combined sources	8

Show more details

3D structure databases

ProteinModelPortalⁱ	Q12918
SMRⁱ	Q12918
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	101 – 211	C-type lectinPROSITE-ProRule annotationAdd BLAST		111

Keywords - Domainⁱ

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG4297 Eukaryota ENOG410XPJ1 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00730000110837
HOGENOMⁱ	HOG000074586
HOVERGENⁱ	HBG052267
InParanoidⁱ	Q12918
KEGG Orthology (KO) More...KOⁱ	K06543
OMAⁱ	NNSLADC
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0QVA
PhylomeDBⁱ	Q12918
TreeFamⁱ	TF337735

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd03593 CLECT_NK_receptors_like, 1 hit
Gene3Dⁱ	3.10.100.10, 1 hit
InterProⁱ	View protein in InterPro IPR001304 C-type_lectin-like IPR016186 C-type_lectin-like/link_sf IPR016187 CTDL_fold IPR033992 NKR-like_CTLD
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00059 Lectin_C, 1 hit
SMARTⁱ	View protein in SMART SM00034 CLECT, 1 hit
SUPFAMⁱ	SSF56436 SSF56436, 1 hit
PROSITEⁱ	View protein in PROSITE PS50041 C_TYPE_LECTIN_2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Q12918-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MDQQAIYAEL NLPTDSGPES SSPSSLPRDV CQGSPWHQFA LKLSCAGIIL 
        60         70         80         90        100
LVLVVTGLSV SVTSLIQKSS IEKCSVDIQQ SRNKTTERPG LLNCPIYWQQ 
       110        120        130        140        150
LREKCLLFSH TVNPWNNSLA DCSTKESSLL LIRDKDELIH TQNLIRDKAI 
       160        170        180        190        200
LFWIGLNFSL SEKNWKWING SFLNSNDLEI RGDAKENSCI SISQTSVYSE 
       210        220 
YCSTEIRWIC QKELTPVRNK VYPDS

Length:225

Mass (Da):25,415

Last modified:November 1, 1996 - v1

Checksum:ⁱ01BFA925445B83B0

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_028981	168	I → T1 PublicationCorresponds to variant dbSNP:rs1135816Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U11276 mRNA Translation: AAA21605.1 BC113997 mRNA Translation: AAI13998.1 BC114516 mRNA Translation: AAI14517.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS8601.1
PIRⁱ	I38700
NCBI Reference Sequences More...RefSeqⁱ	NP_002249.1, NM_002258.2
UniGeneⁱ	Hs.169824

Genome annotation databases

Ensemblⁱ	ENST00000229402; ENSP00000229402; ENSG00000111796
GeneIDⁱ	3820
KEGGⁱ	hsa:3820
UCSC genome browser More...UCSCⁱ	uc010sgt.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q12918	cDNA FLJ75274, highly similar to Homo sapiens killer cell lectin-like receptor subfamily B, member 1(KLRB1), mRNA		HUMAN		225	UniRef90_Q12918
KLRB1 isoform 1		PANTR		225
Killer cell lectin like receptor B1		GORGO		225
KLRB1 isoform 1		PONAB		225
Uncharacterized protein		PANPA		225
+1

Protein	Similar proteins		Species	Score	Length	Source
Q12918	Killer cell lectin-like receptor subfamily B member 1B allele B		RAT		223	UniRef50_Q12918
KLRB1 isoform 1		PANTR		225
KLRB1 isoform 1		PONAB		225
Uncharacterized protein		PANPA		225
Killer cell lectin like receptor B1		GORGO		225
+108

Cross-referencesⁱ

Web resourcesⁱ

Functional Glycomics Gateway - Glycan Binding

NKRP1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U11276 mRNA Translation: AAA21605.1 BC113997 mRNA Translation: AAI13998.1 BC114516 mRNA Translation: AAI14517.1
CCDSⁱ	CCDS8601.1
PIRⁱ	I38700
RefSeqⁱ	NP_002249.1, NM_002258.2
UniGeneⁱ	Hs.169824

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	5MGR	X-ray	1.80	A/B	90-225	[»]
	5MGS	X-ray	1.90	A/B/C/D/E/F/G/H	90-225	[»]
	5MGT	X-ray	1.90	C/D/E/F	90-225	[»]
ProteinModelPortalⁱ	Q12918
SMRⁱ	Q12918
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	Q12918, 2 interactors
STRINGⁱ	9606.ENSP00000229402

Polymorphism and mutation databases

BioMutaⁱ	KLRB1
DMDMⁱ	74722301

Proteomic databases

PaxDbⁱ	Q12918
PeptideAtlasⁱ	Q12918
PRIDEⁱ	Q12918
ProteomicsDBⁱ	59026

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	3820
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000229402; ENSP00000229402; ENSG00000111796
GeneIDⁱ	3820
KEGGⁱ	hsa:3820
UCSCⁱ	uc010sgt.3 human

Organism-specific databases

CTDⁱ	3820
DisGeNETⁱ	3820
EuPathDBⁱ	HostDB:ENSG00000111796.3
GeneCardsⁱ	KLRB1
HGNCⁱ	HGNC:6373 KLRB1
HPAⁱ	HPA039113
MIMⁱ	602890 gene
neXtProtⁱ	NX_Q12918
OpenTargetsⁱ	ENSG00000111796
PharmGKBⁱ	PA30162
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG4297 Eukaryota ENOG410XPJ1 LUCA
GeneTreeⁱ	ENSGT00730000110837
HOGENOMⁱ	HOG000074586
HOVERGENⁱ	HBG052267
InParanoidⁱ	Q12918
KOⁱ	K06543
OMAⁱ	NNSLADC
OrthoDBⁱ	EOG091G0QVA
PhylomeDBⁱ	Q12918
TreeFamⁱ	TF337735

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Reactomeⁱ

R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

GeneWikiⁱ	KLRB1
GenomeRNAiⁱ	3820
Protein Ontology More...PROⁱ	PR:Q12918
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000111796 Expressed in 130 organ(s), highest expression level in mononuclear cell
CleanExⁱ	HS_KLRB1
Genevisibleⁱ	Q12918 HS

Family and domain databases

CDDⁱ	cd03593 CLECT_NK_receptors_like, 1 hit
Gene3Dⁱ	3.10.100.10, 1 hit
InterProⁱ	View protein in InterPro IPR001304 C-type_lectin-like IPR016186 C-type_lectin-like/link_sf IPR016187 CTDL_fold IPR033992 NKR-like_CTLD
Pfamⁱ	View protein in Pfam PF00059 Lectin_C, 1 hit
SMARTⁱ	View protein in SMART SM00034 CLECT, 1 hit
SUPFAMⁱ	SSF56436 SSF56436, 1 hit
PROSITEⁱ	View protein in PROSITE PS50041 C_TYPE_LECTIN_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	KLRB1_HUMAN
Accessionⁱ	Q12918Primary (citable) accession number: Q12918 Secondary accession number(s): Q24K24
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 14, 2006
	Last sequence update:	November 1, 1996
	Last modified:	September 12, 2018
	This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 12
Human chromosome 12: entries, gene names and cross-references to MIM
Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q12918 (KLRB1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Killer cell lectin-like receptor subfamily B member 1

KLRB1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ