Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chromodomain-helicase-DNA-binding protein 3

Gene

CHD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Required for anchoring centrosomal pericentrin in both interphase and mitosis, for spindle organization and centrosome integrity.2 Publications

Miscellaneous

One of the main antigens reacting with anti-MI-2 positive sera of dermatomyositis.

Catalytic activityi

ATP + H2O = ADP + phosphate.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri379 – 426PHD-type 1PROSITE-ProRule annotationAdd BLAST48
Zinc fingeri456 – 503PHD-type 2PROSITE-ProRule annotationAdd BLAST48
Nucleotide bindingi761 – 768ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ATP-dependent DNA helicase activity Source: ProtInc
  • DNA binding Source: ProtInc
  • helicase activity Source: UniProtKB
  • histone deacetylase activity Source: Reactome
  • RNA binding Source: UniProtKB
  • zinc ion binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator, DNA-binding, Helicase, Hydrolase
Biological processTranscription, Transcription regulation
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3214815 HDACs deacetylate histones
R-HSA-427389 ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-6804758 Regulation of TP53 Activity through Acetylation
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-8943724 Regulation of PTEN gene transcription

Protein family/group databases

MoonDBiQ12873 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
Chromodomain-helicase-DNA-binding protein 3 (EC:3.6.4.12)
Short name:
CHD-3
Alternative name(s):
ATP-dependent helicase CHD3
Mi-2 autoantigen 240 kDa protein
Mi2-alpha
Zinc finger helicase
Short name:
hZFH
Gene namesi
Name:CHD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000170004.16
HGNCiHGNC:1918 CHD3
MIMi602120 gene
neXtProtiNX_Q12873

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi1107
OpenTargetsiENSG00000170004
PharmGKBiPA26454

Polymorphism and mutation databases

BioMutaiCHD3
DMDMi88911273

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000802271 – 2000Chromodomain-helicase-DNA-binding protein 3Add BLAST2000

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei79PhosphoserineCombined sources1
Cross-linki120Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki295Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki302Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei308PhosphoserineBy similarity1
Modified residuei324PhosphoserineCombined sources1
Modified residuei376PhosphothreonineBy similarity1
Modified residuei597PhosphoserineCombined sources1
Cross-linki627Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei713PhosphoserineCombined sources1
Cross-linki721Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki721Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei1219PhosphoserineBy similarity1
Cross-linki1222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1238Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1246Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1308Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1367PhosphoserineCombined sources1
Modified residuei1532PhosphoserineBy similarity1
Modified residuei1538PhosphoserineBy similarity1
Cross-linki1573Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1585Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1601PhosphoserineCombined sources1
Modified residuei1605PhosphoserineCombined sources1
Modified residuei1646PhosphothreonineCombined sources1
Cross-linki1876Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1988Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ12873
MaxQBiQ12873
PaxDbiQ12873
PeptideAtlasiQ12873
PRIDEiQ12873
ProteomicsDBi58995
58996 [Q12873-2]

PTM databases

iPTMnetiQ12873
PhosphoSitePlusiQ12873
SwissPalmiQ12873

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000170004 Expressed in 216 organ(s), highest expression level in frontal cortex
CleanExiHS_CHD3
ExpressionAtlasiQ12873 baseline and differential
GenevisibleiQ12873 HS

Organism-specific databases

HPAiHPA043368
HPA076524

Interactioni

Subunit structurei

Central component of the nucleosome remodeling and histone deacetylase (NuRD) repressive complex. Interacts with TRIM28 and SERBP1. Interacts (via its C-terminal) with HABP4. Interacts with PCNT; the interaction regulates centrosome integrity.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi107532, 162 interactors
ComplexPortaliCPX-880 MBD2/NuRD nucleosome remodeling and deacetylase complex
CPX-922 MBD3/NuRD nucleosome remodeling and deacetylase complex
CORUMiQ12873
DIPiDIP-32496N
ELMiQ12873
IntActiQ12873, 125 interactors
MINTiQ12873
STRINGi9606.ENSP00000369716

Structurei

3D structure databases

ProteinModelPortaliQ12873
SMRiQ12873
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini494 – 594Chromo 1PROSITE-ProRule annotationAdd BLAST101
Domaini631 – 673Chromo 2PROSITE-ProRule annotationAdd BLAST43
Domaini748 – 932Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST185
Domaini1064 – 1229Helicase C-terminalPROSITE-ProRule annotationAdd BLAST166

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1566 – 1966Required for interaction with PCNT1 PublicationAdd BLAST401

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi883 – 886DEAH box4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi206 – 221Poly-AlaAdd BLAST16
Compositional biasi243 – 246Poly-Pro4
Compositional biasi355 – 358Poly-Lys4
Compositional biasi434 – 446Poly-GluAdd BLAST13
Compositional biasi697 – 703Poly-Lys7

Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri379 – 426PHD-type 1PROSITE-ProRule annotationAdd BLAST48
Zinc fingeri456 – 503PHD-type 2PROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0383 Eukaryota
COG0553 LUCA
GeneTreeiENSGT00760000119067
HOGENOMiHOG000231124
HOVERGENiHBG005326
InParanoidiQ12873
KOiK11642
OMAiITWRWAV
OrthoDBiEOG091G00G4
PhylomeDBiQ12873
TreeFamiTF106448

Family and domain databases

CDDicd00024 CHROMO, 2 hits
cd00079 HELICc, 1 hit
Gene3Di3.30.40.10, 2 hits
3.40.50.10810, 1 hit
InterProiView protein in InterPro
IPR028722 CHD3
IPR012957 CHD_C2
IPR012958 CHD_N
IPR016197 Chromo-like_dom_sf
IPR000953 Chromo/chromo_shadow_dom
IPR023780 Chromo_domain
IPR023779 Chromodomain_CS
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR009462 DUF1086
IPR009463 DUF1087
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR036910 HMG_box_dom_sf
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR10799:SF544 PTHR10799:SF544, 1 hit
PfamiView protein in Pfam
PF08074 CHDCT2, 1 hit
PF08073 CHDNT, 1 hit
PF00385 Chromo, 1 hit
PF06461 DUF1086, 1 hit
PF06465 DUF1087, 1 hit
PF00271 Helicase_C, 1 hit
PF00628 PHD, 2 hits
PF00176 SNF2_N, 1 hit
SMARTiView protein in SMART
SM00298 CHROMO, 2 hits
SM00487 DEXDc, 1 hit
SM01146 DUF1086, 1 hit
SM01147 DUF1087, 1 hit
SM00490 HELICc, 1 hit
SM00249 PHD, 2 hits
SUPFAMiSSF47095 SSF47095, 1 hit
SSF52540 SSF52540, 2 hits
SSF54160 SSF54160, 2 hits
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS00598 CHROMO_1, 1 hit
PS50013 CHROMO_2, 2 hits
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
PS01359 ZF_PHD_1, 2 hits
PS50016 ZF_PHD_2, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12873-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKAADTVILW ARSKNDQLRI SFPPGLCWGD RMPDKDDIRL LPSALGVKKR
60 70 80 90 100
KRGPKKQKEN KPGKPRKRKK RDSEEEFGSE RDEYREKSES GGSEYGTGPG
110 120 130 140 150
RKRRRKHREK KEKKTKRRKK GEGDGGQKQV EQKSSATLLL TWGLEDVEHV
160 170 180 190 200
FSEEDYHTLT NYKAFSQFMR PLIAKKNPKI PMSKMMTILG AKWREFSANN
210 220 230 240 250
PFKGSAAAVA AAAAAAAAAV AEQVSAAVSS ATPIAPSGPP ALPPPPAADI
260 270 280 290 300
QPPPIRRAKT KEGKGPGHKR RSKSPRVPDG RKKLRGKKMA PLKIKLGLLG
310 320 330 340 350
GKRKKGGSYV FQSDEGPEPE AEESDLDSGS VHSASGRPDG PVRTKKLKRG
360 370 380 390 400
RPGRKKKKVL GCPAVAGEEE VDGYETDHQD YCEVCQQGGE IILCDTCPRA
410 420 430 440 450
YHLVCLDPEL DRAPEGKWSC PHCEKEGVQW EAKEEEEEYE EEGEEEGEKE
460 470 480 490 500
EEDDHMEYCR VCKDGGELLC CDACISSYHI HCLNPPLPDI PNGEWLCPRC
510 520 530 540 550
TCPVLKGRVQ KILHWRWGEP PVAVPAPQQA DGNPDVPPPR PLQGRSEREF
560 570 580 590 600
FVKWVGLSYW HCSWAKELQL EIFHLVMYRN YQRKNDMDEP PPLDYGSGED
610 620 630 640 650
DGKSDKRKVK DPHYAEMEEK YYRFGIKPEW MTVHRIINHS VDKKGNYHYL
660 670 680 690 700
VKWRDLPYDQ STWEEDEMNI PEYEEHKQSY WRHRELIMGE DPAQPRKYKK
710 720 730 740 750
KKKELQGDGP PSSPTNDPTV KYETQPRFIT ATGGTLHMYQ LEGLNWLRFS
760 770 780 790 800
WAQGTDTILA DEMGLGKTIQ TIVFLYSLYK EGHTKGPFLV SAPLSTIINW
810 820 830 840 850
EREFQMWAPK FYVVTYTGDK DSRAIIRENE FSFEDNAIKG GKKAFKMKRE
860 870 880 890 900
AQVKFHVLLT SYELITIDQA ALGSIRWACL VVDEAHRLKN NQSKFFRVLN
910 920 930 940 950
GYKIDHKLLL TGTPLQNNLE ELFHLLNFLT PERFNNLEGF LEEFADISKE
960 970 980 990 1000
DQIKKLHDLL GPHMLRRLKA DVFKNMPAKT ELIVRVELSP MQKKYYKYIL
1010 1020 1030 1040 1050
TRNFEALNSR GGGNQVSLLN IMMDLKKCCN HPYLFPVAAM ESPKLPSGAY
1060 1070 1080 1090 1100
EGGALIKSSG KLMLLQKMLR KLKEQGHRVL IFSQMTKMLD LLEDFLDYEG
1110 1120 1130 1140 1150
YKYERIDGGI TGALRQEAID RFNAPGAQQF CFLLSTRAGG LGINLATADT
1160 1170 1180 1190 1200
VIIFDSDWNP HNDIQAFSRA HRIGQANKVM IYRFVTRASV EERITQVAKR
1210 1220 1230 1240 1250
KMMLTHLVVR PGLGSKAGSM SKQELDDILK FGTEELFKDE NEGENKEEDS
1260 1270 1280 1290 1300
SVIHYDNEAI ARLLDRNQDA TEDTDVQNMN EYLSSFKVAQ YVVREEDKIE
1310 1320 1330 1340 1350
EIEREIIKQE ENVDPDYWEK LLRHHYEQQQ EDLARNLGKG KRVRKQVNYN
1360 1370 1380 1390 1400
DAAQEDQDNQ SEYSVGSEEE DEDFDERPEG RRQSKRQLRN EKDKPLPPLL
1410 1420 1430 1440 1450
ARVGGNIEVL GFNTRQRKAF LNAVMRWGMP PQDAFTTQWL VRDLRGKTEK
1460 1470 1480 1490 1500
EFKAYVSLFM RHLCEPGADG SETFADGVPR EGLSRQQVLT RIGVMSLVKK
1510 1520 1530 1540 1550
KVQEFEHING RWSMPELMPD PSADSKRSSR ASSPTKTSPT TPEASATNSP
1560 1570 1580 1590 1600
CTSKPATPAP SEKGEGIRTP LEKEEAENQE EKPEKNSRIG EKMETEADAP
1610 1620 1630 1640 1650
SPAPSLGERL EPRKIPLEDE VPGVPGEMEP EPGYRGDREK SATESTPGER
1660 1670 1680 1690 1700
GEEKPLDGQE HRERPEGETG DLGKREDVKG DRELRPGPRD EPRSNGRREE
1710 1720 1730 1740 1750
KTEKPRFMFN IADGGFTELH TLWQNEERAA ISSGKLNEIW HRRHDYWLLA
1760 1770 1780 1790 1800
GIVLHGYARW QDIQNDAQFA IINEPFKTEA NKGNFLEMKN KFLARRFKLL
1810 1820 1830 1840 1850
EQALVIEEQL RRAAYLNLSQ EPAHPAMALH ARFAEAECLA ESHQHLSKES
1860 1870 1880 1890 1900
LAGNKPANAV LHKVLNQLEE LLSDMKADVT RLPATLSRIP PIAARLQMSE
1910 1920 1930 1940 1950
RSILSRLASK GTEPHPTPAY PPGPYATPPG YGAAFSAAPV GALAAAGANY
1960 1970 1980 1990 2000
SQMPAGSFIT AATNGPPVLV KKEKEMVGAL VSDGLDRKEP RAGEVICIDD
Length:2,000
Mass (Da):226,592
Last modified:February 7, 2006 - v3
Checksum:i4494F56E5D0E7083
GO
Isoform 2 (identifier: Q12873-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1642-1675: Missing.

Show »
Length:1,966
Mass (Da):222,861
Checksum:iF8D7B7C132B263A6
GO
Isoform 3 (identifier: Q12873-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MKAADTVILWARSKNDQLRISFPPGLCWGDRM → MASPLRDEEE...PLPPPPPPPP

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:2,059
Mass (Da):233,037
Checksum:i3C71593E3C788027
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C2H0H7C2H0_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD3
525Annotation score:
H7C0J3H7C0J3_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD3
383Annotation score:
H7C3H7H7C3H7_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD3
277Annotation score:
I3L229I3L229_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD3
249Annotation score:
K7EPV1K7EPV1_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD3
63Annotation score:
I3L1I4I3L1I4_HUMAN
Chromodomain-helicase-DNA-binding p...
CHD3
110Annotation score:

Sequence cautioni

The sequence AAB87383 differs from that shown. Differs from position 1967 onward for unknown reasons.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti121 – 126GEGDGG → PHFQQK in AAC50228 (PubMed:7560064).Curated6
Sequence conflicti309 – 312Missing in AAC50228 (PubMed:7560064).Curated4
Sequence conflicti653W → G in AAC50228 (PubMed:7560064).Curated1
Sequence conflicti1704K → N in AAC39923 (PubMed:9688266).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0487283A → V. Corresponds to variant dbSNP:rs931543Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470971 – 32MKAAD…WGDRM → MASPLRDEEEEEEEMVVSEE EEEEEEEGDEEEEEEVEAAD EDDEEDDDEGVLGRGPGHDR GRDRHSPPGCHLFPPPPPPP PPLPPPPPPPP in isoform 3. CuratedAdd BLAST32
Alternative sequenceiVSP_0172311642 – 1675Missing in isoform 2. 2 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91543 mRNA Translation: AAC39923.1
AC104581 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90114.1
CH471108 Genomic DNA Translation: EAW90116.1
AF006515 mRNA Translation: AAB87383.1 Different termination.
U08379 mRNA Translation: AAC50228.1
CCDSiCCDS32553.2 [Q12873-3]
CCDS32554.1 [Q12873-1]
CCDS32555.1 [Q12873-2]
RefSeqiNP_001005271.2, NM_001005271.2 [Q12873-3]
NP_001005273.1, NM_001005273.2 [Q12873-1]
NP_005843.2, NM_005852.3 [Q12873-2]
UniGeneiHs.25601

Genome annotation databases

EnsembliENST00000330494; ENSP00000332628; ENSG00000170004 [Q12873-1]
ENST00000358181; ENSP00000350907; ENSG00000170004 [Q12873-2]
ENST00000380358; ENSP00000369716; ENSG00000170004 [Q12873-3]
GeneIDi1107
KEGGihsa:1107
UCSCiuc002gjd.3 human [Q12873-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91543 mRNA Translation: AAC39923.1
AC104581 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90114.1
CH471108 Genomic DNA Translation: EAW90116.1
AF006515 mRNA Translation: AAB87383.1 Different termination.
U08379 mRNA Translation: AAC50228.1
CCDSiCCDS32553.2 [Q12873-3]
CCDS32554.1 [Q12873-1]
CCDS32555.1 [Q12873-2]
RefSeqiNP_001005271.2, NM_001005271.2 [Q12873-3]
NP_001005273.1, NM_001005273.2 [Q12873-1]
NP_005843.2, NM_005852.3 [Q12873-2]
UniGeneiHs.25601

3D structure databases

ProteinModelPortaliQ12873
SMRiQ12873
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107532, 162 interactors
ComplexPortaliCPX-880 MBD2/NuRD nucleosome remodeling and deacetylase complex
CPX-922 MBD3/NuRD nucleosome remodeling and deacetylase complex
CORUMiQ12873
DIPiDIP-32496N
ELMiQ12873
IntActiQ12873, 125 interactors
MINTiQ12873
STRINGi9606.ENSP00000369716

Protein family/group databases

MoonDBiQ12873 Predicted

PTM databases

iPTMnetiQ12873
PhosphoSitePlusiQ12873
SwissPalmiQ12873

Polymorphism and mutation databases

BioMutaiCHD3
DMDMi88911273

Proteomic databases

EPDiQ12873
MaxQBiQ12873
PaxDbiQ12873
PeptideAtlasiQ12873
PRIDEiQ12873
ProteomicsDBi58995
58996 [Q12873-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000330494; ENSP00000332628; ENSG00000170004 [Q12873-1]
ENST00000358181; ENSP00000350907; ENSG00000170004 [Q12873-2]
ENST00000380358; ENSP00000369716; ENSG00000170004 [Q12873-3]
GeneIDi1107
KEGGihsa:1107
UCSCiuc002gjd.3 human [Q12873-1]

Organism-specific databases

CTDi1107
DisGeNETi1107
EuPathDBiHostDB:ENSG00000170004.16
GeneCardsiCHD3
H-InvDBiHIX0013516
HGNCiHGNC:1918 CHD3
HPAiHPA043368
HPA076524
MIMi602120 gene
neXtProtiNX_Q12873
OpenTargetsiENSG00000170004
PharmGKBiPA26454
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0383 Eukaryota
COG0553 LUCA
GeneTreeiENSGT00760000119067
HOGENOMiHOG000231124
HOVERGENiHBG005326
InParanoidiQ12873
KOiK11642
OMAiITWRWAV
OrthoDBiEOG091G00G4
PhylomeDBiQ12873
TreeFamiTF106448

Enzyme and pathway databases

ReactomeiR-HSA-3214815 HDACs deacetylate histones
R-HSA-427389 ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-6804758 Regulation of TP53 Activity through Acetylation
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-8943724 Regulation of PTEN gene transcription

Miscellaneous databases

ChiTaRSiCHD3 human
GeneWikiiCHD3
GenomeRNAii1107
PROiPR:Q12873
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170004 Expressed in 216 organ(s), highest expression level in frontal cortex
CleanExiHS_CHD3
ExpressionAtlasiQ12873 baseline and differential
GenevisibleiQ12873 HS

Family and domain databases

CDDicd00024 CHROMO, 2 hits
cd00079 HELICc, 1 hit
Gene3Di3.30.40.10, 2 hits
3.40.50.10810, 1 hit
InterProiView protein in InterPro
IPR028722 CHD3
IPR012957 CHD_C2
IPR012958 CHD_N
IPR016197 Chromo-like_dom_sf
IPR000953 Chromo/chromo_shadow_dom
IPR023780 Chromo_domain
IPR023779 Chromodomain_CS
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR009462 DUF1086
IPR009463 DUF1087
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR036910 HMG_box_dom_sf
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR10799:SF544 PTHR10799:SF544, 1 hit
PfamiView protein in Pfam
PF08074 CHDCT2, 1 hit
PF08073 CHDNT, 1 hit
PF00385 Chromo, 1 hit
PF06461 DUF1086, 1 hit
PF06465 DUF1087, 1 hit
PF00271 Helicase_C, 1 hit
PF00628 PHD, 2 hits
PF00176 SNF2_N, 1 hit
SMARTiView protein in SMART
SM00298 CHROMO, 2 hits
SM00487 DEXDc, 1 hit
SM01146 DUF1086, 1 hit
SM01147 DUF1087, 1 hit
SM00490 HELICc, 1 hit
SM00249 PHD, 2 hits
SUPFAMiSSF47095 SSF47095, 1 hit
SSF52540 SSF52540, 2 hits
SSF54160 SSF54160, 2 hits
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS00598 CHROMO_1, 1 hit
PS50013 CHROMO_2, 2 hits
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
PS01359 ZF_PHD_1, 2 hits
PS50016 ZF_PHD_2, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCHD3_HUMAN
AccessioniPrimary (citable) accession number: Q12873
Secondary accession number(s): D3DTQ9, E9PG89, Q9Y4I0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: February 7, 2006
Last modified: November 7, 2018
This is version 200 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again