Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (12 Aug 2020)
Sequence version 3 (23 Mar 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Splicing factor, suppressor of white-apricot homolog

Gene

SFSWAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role as an alternative splicing regulator. Regulate its own expression at the level of RNA processing. Also regulates the splicing of fibronectin and CD45 genes. May act, at least in part, by interaction with other R/S-containing splicing factors. Represses the splicing of MAPT/Tau exon 10.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor, RNA-binding
Biological processmRNA processing, mRNA splicing, Transcription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q12872

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Splicing factor, suppressor of white-apricot homolog
Alternative name(s):
Splicing factor, arginine/serine-rich 8
Suppressor of white apricot protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SFSWAP
Synonyms:SFRS8, SWAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000061936.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10790, SFSWAP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601945, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12872

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6433

Open Targets

More...
OpenTargetsi
ENSG00000061936

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35706

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q12872, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SFSWAP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
292495067

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000819341 – 951Splicing factor, suppressor of white-apricot homologAdd BLAST951

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei283PhosphoserineCombined sources1
Modified residuei315N6-acetyllysineCombined sources1
Modified residuei604PhosphoserineCombined sources1
Modified residuei642PhosphothreonineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei834PhosphoserineCombined sources1
Modified residuei905PhosphoserineBy similarity1
Modified residuei909PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q12872

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q12872

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q12872

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q12872

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q12872

PeptideAtlas

More...
PeptideAtlasi
Q12872

PRoteomics IDEntifications database

More...
PRIDEi
Q12872

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
27138
58994 [Q12872-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12872

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12872

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000061936, Expressed in sural nerve and 246 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12872, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12872, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000061936, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
112331, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q12872, 17 interactors

Molecular INTeraction database

More...
MINTi
Q12872

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000437738

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q12872, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1951
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q12872

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q12872

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati211 – 253SURP motif 1Add BLAST43
Repeati459 – 499SURP motif 2Add BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi165 – 168Poly-Glu4
Compositional biasi287 – 290Poly-Asp4
Compositional biasi382 – 385Poly-Pro4
Compositional biasi413 – 416Poly-Pro4
Compositional biasi420 – 424Poly-Pro5
Compositional biasi434 – 440Poly-Thr7
Compositional biasi451 – 454Poly-Pro4
Compositional biasi616 – 619Poly-Ser4
Compositional biasi660 – 663Poly-Ala4
Compositional biasi754 – 763Poly-Lys10
Compositional biasi789 – 951Arg/Ser-rich (RS domain)Add BLAST163
Compositional biasi850 – 853Poly-Lys4

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1847, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153892

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_015459_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12872

Identification of Orthologs from Complete Genome Data

More...
OMAi
LRAEPCQ

Database of Orthologous Groups

More...
OrthoDBi
1414730at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12872

TreeFam database of animal gene trees

More...
TreeFami
TF106264

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.790, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000061, Surp
IPR040397, SWAP
IPR035967, SWAP/Surp_sf
IPR019147, SWAP_N_domain

The PANTHER Classification System

More...
PANTHERi
PTHR13161, PTHR13161, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09750, DRY_EERY, 1 hit
PF01805, Surp, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01141, DRY_EERY, 1 hit
SM00648, SWAP, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109905, SSF109905, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50128, SURP, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12872-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYGASGGRAK PERKSGAKEE AGPGGAGGGG SRVELLVFGY ACKLFRDDER
60 70 80 90 100
ALAQEQGQHL IPWMGDHKIL IDRYDGRGHL HDLSEYDAEY STWNRDYQLS
110 120 130 140 150
EEEARIEALC DEERYLALHT DLLEEEARQE EEYKRLSEAL AEDGSYNAVG
160 170 180 190 200
FTYGSDYYDP SEPTEEEEPS KQREKNEAEN LEENEEPFVA PLGLSVPSDV
210 220 230 240 250
ELPPTAKMHA IIERTASFVC RQGAQFEIML KAKQARNSQF DFLRFDHYLN
260 270 280 290 300
PYYKFIQKAM KEGRYTVLAE NKSDEKKKSG VSSDNEDDDD EEDGNYLHPS
310 320 330 340 350
LFASKKCNRL EELMKPLKVV DPDHPLAALV RKAQADSSTP TPHNADGAPV
360 370 380 390 400
QPSQVEYTAD STVAAMYYSY YMLPDGTYCL APPPPGIDVT TYYSTLPAGV
410 420 430 440 450
TVSNSPGVTT TAPPPPGTTP LPPPTTAETS SGATSTTTTT SALAPVAAII
460 470 480 490 500
PPPPDVQPVI DKLAEYVARN GLKFETSVRA KNDQRFEFLQ PWHQYNAYYE
510 520 530 540 550
FKKQFFLQKE GGDSMQAVSA PEEAPTDSAP EKPSDAGEDG APEDAAEVGA
560 570 580 590 600
RAGSGGKKEA SSSKTVPDGK LVKASFAPIS FAIKAKENDL LPLEKNRVKL
610 620 630 640 650
DDDSDDDEES KEGQESSSSA ANTNPAVAPP CVVVEEKKPQ LTQEELEAKQ
660 670 680 690 700
AKQKLEDRLA AAAREKLAQA SKESKEKQLQ AERKRKAALF LQTLKNPLPE
710 720 730 740 750
AEAGKIEESP FSVEESSTTP CPLLTGGRPL PTLEVKPPDR PSSKSKDPPR
760 770 780 790 800
EEEKEKKKKK HKKRSRTRSR SPKYHSSSKS RSRSHSKAKH SLPSAYRTVR
810 820 830 840 850
RSRSRSRSPR RRAHSPERRR EERSVPTAYR VSRSPGASRK RTRSRSPHEK
860 870 880 890 900
KKKRRSRSRT KSKARSQSVS PSKQAAPRPA APAAHSAHSA SVSPVESRGS
910 920 930 940 950
SQERSRGVSQ EKEAQISSAI VSSVQSKITQ DLMAKVRAML AASKNLQTSA

S
Length:951
Mass (Da):104,822
Last modified:March 23, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA942D589F4B6BF47
GO
Isoform 2 (identifier: Q12872-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     801-801: R → RSRVTASPGTLRAEPCQSSASVTAAAEPGSYQAASTTTRFDSASSFEGKPGKT

Show »
Length:1,003
Mass (Da):110,012
Checksum:iC67AFFE577FF7CA4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YFR9H0YFR9_HUMAN
Splicing factor, suppressor of whit...
SFSWAP
320Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1A5F5H1A5_HUMAN
Splicing factor, suppressor of whit...
SFSWAP
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti236R → P in AAA19604 (PubMed:8206918).Curated1
Sequence conflicti493H → Y in AAA19604 (PubMed:8206918).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04644252L → Q1 PublicationCorresponds to variant dbSNP:rs1051207Ensembl.1
Natural variantiVAR_046443122L → F. Corresponds to variant dbSNP:rs1051314Ensembl.1
Natural variantiVAR_046444136L → F1 PublicationCorresponds to variant dbSNP:rs1131564Ensembl.1
Natural variantiVAR_021789421L → P3 PublicationsCorresponds to variant dbSNP:rs1982528Ensembl.1
Natural variantiVAR_057248512G → S. Corresponds to variant dbSNP:rs34541796Ensembl.1
Natural variantiVAR_057249538E → G. Corresponds to variant dbSNP:rs34744641Ensembl.1
Natural variantiVAR_057250887A → E. Corresponds to variant dbSNP:rs34729193Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044786801R → RSRVTASPGTLRAEPCQSSA SVTAAAEPGSYQAASTTTRF DSASSFEGKPGKT in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U08377 mRNA Translation: AAA19604.1
AC117500 Genomic DNA No translation available.
AC131009 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98526.1
BC008707 mRNA Translation: AAH08707.1
BC015953 mRNA Translation: AAH15953.1
BC136678 mRNA Translation: AAI36679.1
BC144364 mRNA Translation: AAI44365.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58290.1 [Q12872-2]
CCDS9273.1 [Q12872-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A54037
B54037
C54037

NCBI Reference Sequences

More...
RefSeqi
NP_001248340.1, NM_001261411.1 [Q12872-2]
NP_004583.2, NM_004592.3 [Q12872-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261674; ENSP00000261674; ENSG00000061936 [Q12872-1]
ENST00000541286; ENSP00000437738; ENSG00000061936 [Q12872-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6433

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6433

UCSC genome browser

More...
UCSCi
uc001uja.3, human [Q12872-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08377 mRNA Translation: AAA19604.1
AC117500 Genomic DNA No translation available.
AC131009 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98526.1
BC008707 mRNA Translation: AAH08707.1
BC015953 mRNA Translation: AAH15953.1
BC136678 mRNA Translation: AAI36679.1
BC144364 mRNA Translation: AAI44365.1
CCDSiCCDS58290.1 [Q12872-2]
CCDS9273.1 [Q12872-1]
PIRiA54037
B54037
C54037
RefSeqiNP_001248340.1, NM_001261411.1 [Q12872-2]
NP_004583.2, NM_004592.3 [Q12872-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E5ZNMR-A440-522[»]
2E60NMR-A189-282[»]
SMRiQ12872
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112331, 33 interactors
IntActiQ12872, 17 interactors
MINTiQ12872
STRINGi9606.ENSP00000437738

PTM databases

iPTMnetiQ12872
PhosphoSitePlusiQ12872

Polymorphism and mutation databases

BioMutaiSFSWAP
DMDMi292495067

Proteomic databases

EPDiQ12872
jPOSTiQ12872
MassIVEiQ12872
MaxQBiQ12872
PaxDbiQ12872
PeptideAtlasiQ12872
PRIDEiQ12872
ProteomicsDBi27138
58994 [Q12872-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
19429, 172 antibodies

Genome annotation databases

EnsembliENST00000261674; ENSP00000261674; ENSG00000061936 [Q12872-1]
ENST00000541286; ENSP00000437738; ENSG00000061936 [Q12872-2]
GeneIDi6433
KEGGihsa:6433
UCSCiuc001uja.3, human [Q12872-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6433
DisGeNETi6433
EuPathDBiHostDB:ENSG00000061936.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SFSWAP
HGNCiHGNC:10790, SFSWAP
HPAiENSG00000061936, Low tissue specificity
MIMi601945, gene
neXtProtiNX_Q12872
OpenTargetsiENSG00000061936
PharmGKBiPA35706

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1847, Eukaryota
GeneTreeiENSGT00940000153892
HOGENOMiCLU_015459_0_0_1
InParanoidiQ12872
OMAiLRAEPCQ
OrthoDBi1414730at2759
PhylomeDBiQ12872
TreeFamiTF106264

Enzyme and pathway databases

PathwayCommonsiQ12872

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
6433, 560 hits in 879 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SFSWAP, human
EvolutionaryTraceiQ12872

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6433
PharosiQ12872, Tdark

Protein Ontology

More...
PROi
PR:Q12872
RNActiQ12872, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000061936, Expressed in sural nerve and 246 other tissues
ExpressionAtlasiQ12872, baseline and differential
GenevisibleiQ12872, HS

Family and domain databases

Gene3Di1.10.10.790, 2 hits
InterProiView protein in InterPro
IPR000061, Surp
IPR040397, SWAP
IPR035967, SWAP/Surp_sf
IPR019147, SWAP_N_domain
PANTHERiPTHR13161, PTHR13161, 1 hit
PfamiView protein in Pfam
PF09750, DRY_EERY, 1 hit
PF01805, Surp, 2 hits
SMARTiView protein in SMART
SM01141, DRY_EERY, 1 hit
SM00648, SWAP, 2 hits
SUPFAMiSSF109905, SSF109905, 2 hits
PROSITEiView protein in PROSITE
PS50128, SURP, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSFSWA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12872
Secondary accession number(s): B2RN45
, B7ZM97, F5H6B8, Q6PJF7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 23, 2010
Last modified: August 12, 2020
This is version 173 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again