Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Splicing factor, suppressor of white-apricot homolog

Gene

SFSWAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role as an alternative splicing regulator. Regulate its own expression at the level of RNA processing. Also regulates the splicing of fibronectin and CD45 genes. May act, at least in part, by interaction with other R/S-containing splicing factors. Represses the splicing of MAPT/Tau exon 10.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRepressor, RNA-binding
Biological processmRNA processing, mRNA splicing, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Splicing factor, suppressor of white-apricot homolog
Alternative name(s):
Splicing factor, arginine/serine-rich 8
Suppressor of white apricot protein homolog
Gene namesi
Name:SFSWAP
Synonyms:SFRS8, SWAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000061936.9
HGNCiHGNC:10790 SFSWAP
MIMi601945 gene
neXtProtiNX_Q12872

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi6433
OpenTargetsiENSG00000061936
PharmGKBiPA35706

Polymorphism and mutation databases

BioMutaiSFSWAP
DMDMi292495067

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000819341 – 951Splicing factor, suppressor of white-apricot homologAdd BLAST951

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei283PhosphoserineCombined sources1
Modified residuei315N6-acetyllysineCombined sources1
Modified residuei604PhosphoserineCombined sources1
Modified residuei642PhosphothreonineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei834PhosphoserineCombined sources1
Modified residuei905PhosphoserineBy similarity1
Modified residuei909PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ12872
MaxQBiQ12872
PaxDbiQ12872
PeptideAtlasiQ12872
PRIDEiQ12872
ProteomicsDBi58994

PTM databases

iPTMnetiQ12872
PhosphoSitePlusiQ12872

Expressioni

Gene expression databases

BgeeiENSG00000061936 Expressed in 238 organ(s), highest expression level in tendon of biceps brachii
CleanExiHS_SFRS8
ExpressionAtlasiQ12872 baseline and differential
GenevisibleiQ12872 HS

Organism-specific databases

HPAiHPA039362
HPA040063

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SF1Q156372EBI-1055938,EBI-744603

Protein-protein interaction databases

BioGridi112331, 24 interactors
IntActiQ12872, 9 interactors
MINTiQ12872
STRINGi9606.ENSP00000261674

Structurei

Secondary structure

1951
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ12872
SMRiQ12872
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ12872

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati211 – 253SURP motif 1Add BLAST43
Repeati459 – 499SURP motif 2Add BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi165 – 168Poly-Glu4
Compositional biasi287 – 290Poly-Asp4
Compositional biasi382 – 385Poly-Pro4
Compositional biasi413 – 416Poly-Pro4
Compositional biasi420 – 424Poly-Pro5
Compositional biasi434 – 440Poly-Thr7
Compositional biasi451 – 454Poly-Pro4
Compositional biasi616 – 619Poly-Ser4
Compositional biasi660 – 663Poly-Ala4
Compositional biasi754 – 763Poly-Lys10
Compositional biasi789 – 951Arg/Ser-rich (RS domain)Add BLAST163
Compositional biasi850 – 853Poly-Lys4

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1847 Eukaryota
ENOG410ZQGI LUCA
GeneTreeiENSGT00730000111096
HOVERGENiHBG079184
InParanoidiQ12872
OMAiVDVATYY
OrthoDBiEOG091G09RJ
PhylomeDBiQ12872
TreeFamiTF106264

Family and domain databases

Gene3Di1.10.10.790, 2 hits
InterProiView protein in InterPro
IPR000061 Surp
IPR035967 SWAP/Surp_sf
IPR019147 SWAP_N_domain
PfamiView protein in Pfam
PF09750 DRY_EERY, 1 hit
PF01805 Surp, 2 hits
SMARTiView protein in SMART
SM01141 DRY_EERY, 1 hit
SM00648 SWAP, 2 hits
SUPFAMiSSF109905 SSF109905, 2 hits
PROSITEiView protein in PROSITE
PS50128 SURP, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12872-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYGASGGRAK PERKSGAKEE AGPGGAGGGG SRVELLVFGY ACKLFRDDER
60 70 80 90 100
ALAQEQGQHL IPWMGDHKIL IDRYDGRGHL HDLSEYDAEY STWNRDYQLS
110 120 130 140 150
EEEARIEALC DEERYLALHT DLLEEEARQE EEYKRLSEAL AEDGSYNAVG
160 170 180 190 200
FTYGSDYYDP SEPTEEEEPS KQREKNEAEN LEENEEPFVA PLGLSVPSDV
210 220 230 240 250
ELPPTAKMHA IIERTASFVC RQGAQFEIML KAKQARNSQF DFLRFDHYLN
260 270 280 290 300
PYYKFIQKAM KEGRYTVLAE NKSDEKKKSG VSSDNEDDDD EEDGNYLHPS
310 320 330 340 350
LFASKKCNRL EELMKPLKVV DPDHPLAALV RKAQADSSTP TPHNADGAPV
360 370 380 390 400
QPSQVEYTAD STVAAMYYSY YMLPDGTYCL APPPPGIDVT TYYSTLPAGV
410 420 430 440 450
TVSNSPGVTT TAPPPPGTTP LPPPTTAETS SGATSTTTTT SALAPVAAII
460 470 480 490 500
PPPPDVQPVI DKLAEYVARN GLKFETSVRA KNDQRFEFLQ PWHQYNAYYE
510 520 530 540 550
FKKQFFLQKE GGDSMQAVSA PEEAPTDSAP EKPSDAGEDG APEDAAEVGA
560 570 580 590 600
RAGSGGKKEA SSSKTVPDGK LVKASFAPIS FAIKAKENDL LPLEKNRVKL
610 620 630 640 650
DDDSDDDEES KEGQESSSSA ANTNPAVAPP CVVVEEKKPQ LTQEELEAKQ
660 670 680 690 700
AKQKLEDRLA AAAREKLAQA SKESKEKQLQ AERKRKAALF LQTLKNPLPE
710 720 730 740 750
AEAGKIEESP FSVEESSTTP CPLLTGGRPL PTLEVKPPDR PSSKSKDPPR
760 770 780 790 800
EEEKEKKKKK HKKRSRTRSR SPKYHSSSKS RSRSHSKAKH SLPSAYRTVR
810 820 830 840 850
RSRSRSRSPR RRAHSPERRR EERSVPTAYR VSRSPGASRK RTRSRSPHEK
860 870 880 890 900
KKKRRSRSRT KSKARSQSVS PSKQAAPRPA APAAHSAHSA SVSPVESRGS
910 920 930 940 950
SQERSRGVSQ EKEAQISSAI VSSVQSKITQ DLMAKVRAML AASKNLQTSA

S
Length:951
Mass (Da):104,822
Last modified:March 23, 2010 - v3
Checksum:iA942D589F4B6BF47
GO
Isoform 2 (identifier: Q12872-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     801-801: R → RSRVTASPGTLRAEPCQSSASVTAAAEPGSYQAASTTTRFDSASSFEGKPGKT

Note: No experimental confirmation available.
Show »
Length:1,003
Mass (Da):110,012
Checksum:iC67AFFE577FF7CA4
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YFR9H0YFR9_HUMAN
Splicing factor, suppressor of whit...
SFSWAP
320Annotation score:
F5H1A5F5H1A5_HUMAN
Splicing factor, suppressor of whit...
SFSWAP
121Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti236R → P in AAA19604 (PubMed:8206918).Curated1
Sequence conflicti493H → Y in AAA19604 (PubMed:8206918).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04644252L → Q1 PublicationCorresponds to variant dbSNP:rs1051207Ensembl.1
Natural variantiVAR_046443122L → F. Corresponds to variant dbSNP:rs1051314Ensembl.1
Natural variantiVAR_046444136L → F1 PublicationCorresponds to variant dbSNP:rs1131564Ensembl.1
Natural variantiVAR_021789421L → P3 PublicationsCorresponds to variant dbSNP:rs1982528Ensembl.1
Natural variantiVAR_057248512G → S. Corresponds to variant dbSNP:rs34541796Ensembl.1
Natural variantiVAR_057249538E → G. Corresponds to variant dbSNP:rs34744641Ensembl.1
Natural variantiVAR_057250887A → E. Corresponds to variant dbSNP:rs34729193Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044786801R → RSRVTASPGTLRAEPCQSSA SVTAAAEPGSYQAASTTTRF DSASSFEGKPGKT in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08377 mRNA Translation: AAA19604.1
AC117500 Genomic DNA No translation available.
AC131009 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98526.1
BC008707 mRNA Translation: AAH08707.1
BC015953 mRNA Translation: AAH15953.1
BC136678 mRNA Translation: AAI36679.1
BC144364 mRNA Translation: AAI44365.1
CCDSiCCDS58290.1 [Q12872-2]
CCDS9273.1 [Q12872-1]
PIRiA54037
B54037
C54037
RefSeqiNP_001248340.1, NM_001261411.1 [Q12872-2]
NP_004583.2, NM_004592.3 [Q12872-1]
UniGeneiHs.308171

Genome annotation databases

EnsembliENST00000261674; ENSP00000261674; ENSG00000061936 [Q12872-1]
ENST00000541286; ENSP00000437738; ENSG00000061936 [Q12872-2]
GeneIDi6433
KEGGihsa:6433
UCSCiuc001uja.3 human [Q12872-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08377 mRNA Translation: AAA19604.1
AC117500 Genomic DNA No translation available.
AC131009 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98526.1
BC008707 mRNA Translation: AAH08707.1
BC015953 mRNA Translation: AAH15953.1
BC136678 mRNA Translation: AAI36679.1
BC144364 mRNA Translation: AAI44365.1
CCDSiCCDS58290.1 [Q12872-2]
CCDS9273.1 [Q12872-1]
PIRiA54037
B54037
C54037
RefSeqiNP_001248340.1, NM_001261411.1 [Q12872-2]
NP_004583.2, NM_004592.3 [Q12872-1]
UniGeneiHs.308171

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E5ZNMR-A440-522[»]
2E60NMR-A189-282[»]
ProteinModelPortaliQ12872
SMRiQ12872
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112331, 24 interactors
IntActiQ12872, 9 interactors
MINTiQ12872
STRINGi9606.ENSP00000261674

PTM databases

iPTMnetiQ12872
PhosphoSitePlusiQ12872

Polymorphism and mutation databases

BioMutaiSFSWAP
DMDMi292495067

Proteomic databases

EPDiQ12872
MaxQBiQ12872
PaxDbiQ12872
PeptideAtlasiQ12872
PRIDEiQ12872
ProteomicsDBi58994

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261674; ENSP00000261674; ENSG00000061936 [Q12872-1]
ENST00000541286; ENSP00000437738; ENSG00000061936 [Q12872-2]
GeneIDi6433
KEGGihsa:6433
UCSCiuc001uja.3 human [Q12872-1]

Organism-specific databases

CTDi6433
DisGeNETi6433
EuPathDBiHostDB:ENSG00000061936.9
GeneCardsiSFSWAP
H-InvDBiHIX0036782
HGNCiHGNC:10790 SFSWAP
HPAiHPA039362
HPA040063
MIMi601945 gene
neXtProtiNX_Q12872
OpenTargetsiENSG00000061936
PharmGKBiPA35706
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1847 Eukaryota
ENOG410ZQGI LUCA
GeneTreeiENSGT00730000111096
HOVERGENiHBG079184
InParanoidiQ12872
OMAiVDVATYY
OrthoDBiEOG091G09RJ
PhylomeDBiQ12872
TreeFamiTF106264

Miscellaneous databases

ChiTaRSiSFSWAP human
EvolutionaryTraceiQ12872
GenomeRNAii6433
PROiPR:Q12872
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000061936 Expressed in 238 organ(s), highest expression level in tendon of biceps brachii
CleanExiHS_SFRS8
ExpressionAtlasiQ12872 baseline and differential
GenevisibleiQ12872 HS

Family and domain databases

Gene3Di1.10.10.790, 2 hits
InterProiView protein in InterPro
IPR000061 Surp
IPR035967 SWAP/Surp_sf
IPR019147 SWAP_N_domain
PfamiView protein in Pfam
PF09750 DRY_EERY, 1 hit
PF01805 Surp, 2 hits
SMARTiView protein in SMART
SM01141 DRY_EERY, 1 hit
SM00648 SWAP, 2 hits
SUPFAMiSSF109905 SSF109905, 2 hits
PROSITEiView protein in PROSITE
PS50128 SURP, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiSFSWA_HUMAN
AccessioniPrimary (citable) accession number: Q12872
Secondary accession number(s): B2RN45
, B7ZM97, F5H6B8, Q6PJF7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 23, 2010
Last modified: November 7, 2018
This is version 160 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again