Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q12857 (NFIA_HUMAN)

Entry version 194 (25 May 2022)
Sequence version 2 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear factor 1 A-type

Gene

NFIA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi1 – 194CTF/NF-IPROSITE-ProRule annotationAdd BLAST194

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processDNA replication, Transcription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q12857

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-73980, RNA Polymerase III Transcription Termination
R-HSA-749476, RNA Polymerase III Abortive And Retractive Initiation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q12857

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q12857

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NFIA
Synonyms:KIAA1439
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7784, NFIA

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600727, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q12857

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000162599

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Brain malformations with or without urinary tract defects (BRMUTD)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by corpus callosum hypoplasia or agenesis, hydrocephalus or ventricular enlargement, developmental delay, and urinary tract defects.
Related information in OMIM

Organism-specific databases

DisGeNET

More...DisGeNETi		4774

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		NFIA

MalaCards human disease database

More...MalaCardsi		NFIA
MIMi613735, phenotype

Open Targets

More...OpenTargetsi		ENSG00000162599

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		401986, 1p31p32 microdeletion syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31590

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q12857, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NFIA

Domain mapping of disease mutations (DMDM)

More...DMDMi		14194959

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001001911 – 509Nuclear factor 1 A-typeAdd BLAST509

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei258PhosphoserineCombined sources1
Modified residuei265PhosphoserineCombined sources1
Modified residuei280PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei300PhosphoserineCombined sources1
Modified residuei305PhosphoserineBy similarity1
Modified residuei319PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1
Modified residuei389Asymmetric dimethylarginineBy similarity1
Modified residuei469PhosphoserineCombined sources1
Modified residuei471PhosphothreonineCombined sources1
Isoform 2 (identifier: Q12857-2)
Modified residuei469PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q12857

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q12857

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q12857

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q12857

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q12857

PeptideAtlas

More...PeptideAtlasi		Q12857

PRoteomics IDEntifications database

More...PRIDEi		Q12857

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25418
30217
58986 [Q12857-1]
58987 [Q12857-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q12857, 3 sites, 2 O-linked glycans (3 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q12857

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q12857

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000162599, Expressed in oviduct epithelium and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q12857, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q12857, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000162599, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110847, 60 interactors

Protein interaction database and analysis system

More...IntActi		Q12857, 134 interactors

Molecular INTeraction database

More...MINTi		Q12857

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000360231

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q12857, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q12857

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni189 – 211DisorderedSequence analysisAdd BLAST23
Regioni259 – 345DisorderedSequence analysisAdd BLAST87
Regioni352 – 371DisorderedSequence analysisAdd BLAST20
Regioni435 – 509DisorderedSequence analysisAdd BLAST75

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi394 – 4029aaTAD1 Publication9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi259 – 276Polar residuesSequence analysisAdd BLAST18
Compositional biasi298 – 312Polar residuesSequence analysisAdd BLAST15
Compositional biasi322 – 345Polar residuesSequence analysisAdd BLAST24
Compositional biasi435 – 457Pro residuesSequence analysisAdd BLAST23
Compositional biasi458 – 486Polar residuesSequence analysisAdd BLAST29
Compositional biasi495 – 509Polar residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3663, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182916

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q12857

Identification of Orthologs from Complete Genome Data

More...OMAi		XSPHATP

Database of Orthologous Groups

More...OrthoDBi		967862at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q12857

TreeFam database of animal gene trees

More...TreeFami		TF313889

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000647, CTF/NFI
IPR020604, CTF/NFI_DNA-bd-dom
IPR019739, CTF/NFI_DNA-bd_CS
IPR019548, CTF/NFI_DNA-bd_N
IPR003619, MAD_homology1_Dwarfin-type

The PANTHER Classification System

More...PANTHERi		PTHR11492, PTHR11492, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00859, CTF_NFI, 1 hit
PF03165, MH1, 1 hit
PF10524, NfI_DNAbd_pre-N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00523, DWA, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00349, CTF_NFI_1, 1 hit
PS51080, CTF_NFI_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12857-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYSPLCLTQD EFHPFIEALL PHVRAFAYTW FNLQARKRKY FKKHEKRMSK 
        60         70         80         90        100
EEERAVKDEL LSEKPEVKQK WASRLLAKLR KDIRPEYRED FVLTVTGKKP 
       110        120        130        140        150
PCCVLSNPDQ KGKMRRIDCL RQADKVWRLD LVMVILFKGI PLESTDGERL 
       160        170        180        190        200
VKSPQCSNPG LCVQPHHIGV SVKELDLYLA YFVHAADSSQ SESPSQPSDA 
       210        220        230        240        250
DIKDQPENGH LGFQDSFVTS GVFSVTELVR VSQTPIAAGT GPNFSLSDLE 
       260        270        280        290        300
SSSYYSMSPG AMRRSLPSTS STSSTKRLKS VEDEMDSPGE EPFYTGQGRS 
       310        320        330        340        350
PGSGSQSSGW HEVEPGMPSP TTLKKSEKSG FSSPSPSQTS SLGTAFTQHH 
       360        370        380        390        400
RPVITGPRAS PHATPSTLHF PTSPIIQQPG PYFSHPAIRY HPQETLKEFV 
       410        420        430        440        450
QLVCPDAGQQ AGQVGFLNPN GSSQGKVHNP FLPTPMLPPP PPPPMARPVP 
       460        470        480        490        500
LPVPDTKPPT TSTEGGAASP TSPTYSTPST SPANRFVSVG PRDPSFVNIP 

QQTQSWYLG
Length:509
Mass (Da):55,944
Last modified:June 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i42090C6B8B229F87
GO
Isoform 2 (identifier: Q12857-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     474-509: TYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG → ILVPGIKVAASHHPPDRPPDPFSTL

Show »
Length:498
Mass (Da):54,620
Checksum:i0C47EA46EC78030C
GO
Isoform 3 (identifier: Q12857-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MYSPLCLTQ → M

Show »
Length:501
Mass (Da):55,038
Checksum:i871DB7C2ACA49A5B
GO
Isoform 4 (identifier: Q12857-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQMCRPASSSVLYVPTRWPGGCGATWQSCPSPPPRRTRIPQRPAVM

Show »
Length:554
Mass (Da):60,894
Checksum:iE05E93FF6701A134
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AKN8B1AKN8_HUMAN
Nuclear factor 1
NFIA
532Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKN5B1AKN5_HUMAN
Nuclear factor 1
NFIA
487Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UK09A0A590UK09_HUMAN
Nuclear factor 1
NFIA
508Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKN7B1AKN7_HUMAN
Nuclear factor 1
NFIA
466Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKN6B1AKN6_HUMAN
Nuclear factor 1
NFIA
380Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UK73A0A590UK73_HUMAN
Nuclear factor 1
NFIA
326Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3K4S4R3K4_HUMAN
Nuclear factor 1
NFIA
186Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UJ82A0A590UJ82_HUMAN
CCAAT-box-binding transcription fac...
NFIA
198Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3W2S4R3W2_HUMAN
Nuclear factor 1 A-type
NFIA
184Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UJU2A0A590UJU2_HUMAN
Nuclear factor 1 A-type
NFIA hCG_2032260
242Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92677 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti143E → G in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti186A → G in AAA93124 (PubMed:7590749).Curated1
Sequence conflicti240 – 243TGPN → PAPT in AAA93124 (PubMed:7590749).Curated4
Sequence conflicti274S → P in BAG61515 (PubMed:14702039).Curated1
Sequence conflicti331F → L in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti358R → G in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti426K → R in BAG61305 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0468841 – 9MYSPLCLTQ → M in isoform 3. 1 Publication9
Alternative sequenceiVSP_0468831M → MQMCRPASSSVLYVPTRWPG GCGATWQSCPSPPPRRTRIP QRPAVM in isoform 4. 1 Publication1
Alternative sequenceiVSP_036620474 – 509TYSTP…SWYLG → ILVPGIKVAASHHPPDRPPD PFSTL in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB037860 mRNA Translation: BAA92677.1 Different initiation.
AK299289 mRNA Translation: BAG61305.1
AK299579 mRNA Translation: BAG61515.1
AC092784 Genomic DNA No translation available.
AC096534 Genomic DNA No translation available.
AC096947 Genomic DNA No translation available.
AC099792 Genomic DNA No translation available.
AL096888 Genomic DNA No translation available.
AL355795 Genomic DNA No translation available.
AL445198 Genomic DNA No translation available.
AL445432 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06601.1
BC022264 mRNA Translation: AAH22264.1
U07809 mRNA Translation: AAA93124.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44156.1 [Q12857-1]
CCDS53321.1 [Q12857-3]
CCDS53322.1 [Q12857-4]
CCDS615.1 [Q12857-2]

NCBI Reference Sequences

More...RefSeqi		NP_001128145.1, NM_001134673.3 [Q12857-1]
NP_001138983.1, NM_001145511.1 [Q12857-3]
NP_001138984.1, NM_001145512.1 [Q12857-4]
NP_005586.1, NM_005595.4 [Q12857-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000371187.7; ENSP00000360229.3; ENSG00000162599.17 [Q12857-2]
ENST00000371189.8; ENSP00000360231.3; ENSG00000162599.17 [Q12857-4]
ENST00000403491.8; ENSP00000384523.3; ENSG00000162599.17
ENST00000407417.7; ENSP00000384680.2; ENSG00000162599.17 [Q12857-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4774

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4774

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000403491.8; ENSP00000384523.3; NM_001134673.4; NP_001128145.1

UCSC genome browser

More...UCSCi		uc001czv.4, human [Q12857-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037860 mRNA Translation: BAA92677.1 Different initiation.
AK299289 mRNA Translation: BAG61305.1
AK299579 mRNA Translation: BAG61515.1
AC092784 Genomic DNA No translation available.
AC096534 Genomic DNA No translation available.
AC096947 Genomic DNA No translation available.
AC099792 Genomic DNA No translation available.
AL096888 Genomic DNA No translation available.
AL355795 Genomic DNA No translation available.
AL445198 Genomic DNA No translation available.
AL445432 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06601.1
BC022264 mRNA Translation: AAH22264.1
U07809 mRNA Translation: AAA93124.1
CCDSiCCDS44156.1 [Q12857-1]
CCDS53321.1 [Q12857-3]
CCDS53322.1 [Q12857-4]
CCDS615.1 [Q12857-2]
RefSeqiNP_001128145.1, NM_001134673.3 [Q12857-1]
NP_001138983.1, NM_001145511.1 [Q12857-3]
NP_001138984.1, NM_001145512.1 [Q12857-4]
NP_005586.1, NM_005595.4 [Q12857-2]

3D structure databases

AlphaFoldDBiQ12857
ModBaseiSearch...
SWISS-MODEL-WorkspaceiSubmit a new modelling project...

Protein-protein interaction databases

BioGRIDi110847, 60 interactors
IntActiQ12857, 134 interactors
MINTiQ12857
STRINGi9606.ENSP00000360231

PTM databases

GlyGeniQ12857, 3 sites, 2 O-linked glycans (3 sites)
iPTMnetiQ12857
PhosphoSitePlusiQ12857

Genetic variation databases

BioMutaiNFIA
DMDMi14194959

Proteomic databases

EPDiQ12857
jPOSTiQ12857
MassIVEiQ12857
MaxQBiQ12857
PaxDbiQ12857
PeptideAtlasiQ12857
PRIDEiQ12857
ProteomicsDBi25418
30217
58986 [Q12857-1]
58987 [Q12857-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1812, 277 antibodies from 31 providers

The DNASU plasmid repository

More...DNASUi		4774

Genome annotation databases

EnsembliENST00000371187.7; ENSP00000360229.3; ENSG00000162599.17 [Q12857-2]
ENST00000371189.8; ENSP00000360231.3; ENSG00000162599.17 [Q12857-4]
ENST00000403491.8; ENSP00000384523.3; ENSG00000162599.17
ENST00000407417.7; ENSP00000384680.2; ENSG00000162599.17 [Q12857-3]
GeneIDi4774
KEGGihsa:4774
MANE-SelectiENST00000403491.8; ENSP00000384523.3; NM_001134673.4; NP_001128145.1
UCSCiuc001czv.4, human [Q12857-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4774
DisGeNETi4774

GeneCards: human genes, protein and diseases

More...GeneCardsi		NFIA
GeneReviewsiNFIA
HGNCiHGNC:7784, NFIA
HPAiENSG00000162599, Tissue enhanced (brain)
MalaCardsiNFIA
MIMi600727, gene
613735, phenotype
neXtProtiNX_Q12857
OpenTargetsiENSG00000162599
Orphaneti401986, 1p31p32 microdeletion syndrome
PharmGKBiPA31590
VEuPathDBiHostDB:ENSG00000162599

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3663, Eukaryota
GeneTreeiENSGT00950000182916
InParanoidiQ12857
OMAiXSPHATP
OrthoDBi967862at2759
PhylomeDBiQ12857
TreeFamiTF313889

Enzyme and pathway databases

PathwayCommonsiQ12857
ReactomeiR-HSA-73980, RNA Polymerase III Transcription Termination
R-HSA-749476, RNA Polymerase III Abortive And Retractive Initiation
SignaLinkiQ12857
SIGNORiQ12857

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4774, 15 hits in 1105 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NFIA, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NFIA

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4774
PharosiQ12857, Tbio

Protein Ontology

More...PROi		PR:Q12857
RNActiQ12857, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000162599, Expressed in oviduct epithelium and 225 other tissues
ExpressionAtlasiQ12857, baseline and differential
GenevisibleiQ12857, HS

Family and domain databases

InterProiView protein in InterPro
IPR000647, CTF/NFI
IPR020604, CTF/NFI_DNA-bd-dom
IPR019739, CTF/NFI_DNA-bd_CS
IPR019548, CTF/NFI_DNA-bd_N
IPR003619, MAD_homology1_Dwarfin-type
PANTHERiPTHR11492, PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859, CTF_NFI, 1 hit
PF03165, MH1, 1 hit
PF10524, NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523, DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349, CTF_NFI_1, 1 hit
PS51080, CTF_NFI_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFIA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12857
Secondary accession number(s): B4DRJ3
, B4DS53, F5H0R0, F8W8W3, Q8TA97, Q9H3X9, Q9P2A9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: June 1, 2001
Last modified: May 25, 2022
This is version 194 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again