Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (11 Dec 2019)
Sequence version 2 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear factor 1 A-type

Gene

NFIA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi1 – 194CTF/NF-IPROSITE-ProRule annotationAdd BLAST194

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processDNA replication, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q12857

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NFIA
Synonyms:KIAA1439
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000162599.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7784 NFIA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600727 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12857

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Brain malformations with or without urinary tract defects (BRMUTD)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by corpus callosum hypoplasia or agenesis, hydrocephalus or ventricular enlargement, developmental delay, and urinary tract defects.
Related information in OMIM

Organism-specific databases

DisGeNET

More...
DisGeNETi
4774

MalaCards human disease database

More...
MalaCardsi
NFIA
MIMi613735 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000162599

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
401986 1p31p32 microdeletion syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31590

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q12857 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NFIA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
14194959

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001001911 – 509Nuclear factor 1 A-typeAdd BLAST509

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei258PhosphoserineCombined sources1
Modified residuei265PhosphoserineCombined sources1
Modified residuei280PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei300PhosphoserineCombined sources1
Modified residuei305PhosphoserineBy similarity1
Modified residuei319PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1
Modified residuei389Asymmetric dimethylarginineBy similarity1
Modified residuei469PhosphoserineCombined sources1
Modified residuei471PhosphothreonineCombined sources1
Isoform 2 (identifier: Q12857-2)
Modified residuei469PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q12857

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q12857

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q12857

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q12857

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q12857

PeptideAtlas

More...
PeptideAtlasi
Q12857

PRoteomics IDEntifications database

More...
PRIDEi
Q12857

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25418
30217
58986 [Q12857-1]
58987 [Q12857-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12857

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12857

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162599 Expressed in 211 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12857 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12857 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006111
HPA008884

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
A0A0S2Z4H33EBI-12119652,EBI-16430952

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110847, 49 interactors

Protein interaction database and analysis system

More...
IntActi
Q12857, 13 interactors

Molecular INTeraction database

More...
MINTi
Q12857

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360231

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q12857 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi394 – 4029aaTAD1 Publication9

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3663 Eukaryota
ENOG410Y16G LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182916

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013028

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12857

KEGG Orthology (KO)

More...
KOi
K09168

Identification of Orthologs from Complete Genome Data

More...
OMAi
XSPHATP

Database of Orthologous Groups

More...
OrthoDBi
967862at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12857

TreeFam database of animal gene trees

More...
TreeFami
TF313889

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000647 CTF/NFI
IPR020604 CTF/NFI_DNA-bd-dom
IPR019739 CTF/NFI_DNA-bd_CS
IPR019548 CTF/NFI_DNA-bd_N
IPR003619 MAD_homology1_Dwarfin-type

The PANTHER Classification System

More...
PANTHERi
PTHR11492 PTHR11492, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00859 CTF_NFI, 1 hit
PF03165 MH1, 1 hit
PF10524 NfI_DNAbd_pre-N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00523 DWA, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00349 CTF_NFI_1, 1 hit
PS51080 CTF_NFI_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12857-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYSPLCLTQD EFHPFIEALL PHVRAFAYTW FNLQARKRKY FKKHEKRMSK
60 70 80 90 100
EEERAVKDEL LSEKPEVKQK WASRLLAKLR KDIRPEYRED FVLTVTGKKP
110 120 130 140 150
PCCVLSNPDQ KGKMRRIDCL RQADKVWRLD LVMVILFKGI PLESTDGERL
160 170 180 190 200
VKSPQCSNPG LCVQPHHIGV SVKELDLYLA YFVHAADSSQ SESPSQPSDA
210 220 230 240 250
DIKDQPENGH LGFQDSFVTS GVFSVTELVR VSQTPIAAGT GPNFSLSDLE
260 270 280 290 300
SSSYYSMSPG AMRRSLPSTS STSSTKRLKS VEDEMDSPGE EPFYTGQGRS
310 320 330 340 350
PGSGSQSSGW HEVEPGMPSP TTLKKSEKSG FSSPSPSQTS SLGTAFTQHH
360 370 380 390 400
RPVITGPRAS PHATPSTLHF PTSPIIQQPG PYFSHPAIRY HPQETLKEFV
410 420 430 440 450
QLVCPDAGQQ AGQVGFLNPN GSSQGKVHNP FLPTPMLPPP PPPPMARPVP
460 470 480 490 500
LPVPDTKPPT TSTEGGAASP TSPTYSTPST SPANRFVSVG PRDPSFVNIP

QQTQSWYLG
Length:509
Mass (Da):55,944
Last modified:June 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i42090C6B8B229F87
GO
Isoform 2 (identifier: Q12857-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     474-509: TYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG → ILVPGIKVAASHHPPDRPPDPFSTL

Show »
Length:498
Mass (Da):54,620
Checksum:i0C47EA46EC78030C
GO
Isoform 3 (identifier: Q12857-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MYSPLCLTQ → M

Show »
Length:501
Mass (Da):55,038
Checksum:i871DB7C2ACA49A5B
GO
Isoform 4 (identifier: Q12857-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQMCRPASSSVLYVPTRWPGGCGATWQSCPSPPPRRTRIPQRPAVM

Show »
Length:554
Mass (Da):60,894
Checksum:iE05E93FF6701A134
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AKN5B1AKN5_HUMAN
Nuclear factor 1
NFIA
487Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKN8B1AKN8_HUMAN
Nuclear factor 1
NFIA
532Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKN7B1AKN7_HUMAN
Nuclear factor 1
NFIA
466Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKN6B1AKN6_HUMAN
Nuclear factor 1
NFIA
380Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3K4S4R3K4_HUMAN
Nuclear factor 1
NFIA
186Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UK09A0A590UK09_HUMAN
Nuclear factor 1
NFIA
508Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UK73A0A590UK73_HUMAN
Nuclear factor 1
NFIA
326Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3W2S4R3W2_HUMAN
Nuclear factor 1 A-type
NFIA
184Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3K5S4R3K5_HUMAN
Nuclear factor 1 A-type
NFIA
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R308S4R308_HUMAN
Nuclear factor 1 A-type
NFIA
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92677 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti143E → G in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti186A → G in AAA93124 (PubMed:7590749).Curated1
Sequence conflicti240 – 243TGPN → PAPT in AAA93124 (PubMed:7590749).Curated4
Sequence conflicti274S → P in BAG61515 (PubMed:14702039).Curated1
Sequence conflicti331F → L in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti358R → G in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti426K → R in BAG61305 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0468841 – 9MYSPLCLTQ → M in isoform 3. 1 Publication9
Alternative sequenceiVSP_0468831M → MQMCRPASSSVLYVPTRWPG GCGATWQSCPSPPPRRTRIP QRPAVM in isoform 4. 1 Publication1
Alternative sequenceiVSP_036620474 – 509TYSTP…SWYLG → ILVPGIKVAASHHPPDRPPD PFSTL in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB037860 mRNA Translation: BAA92677.1 Different initiation.
AK299289 mRNA Translation: BAG61305.1
AK299579 mRNA Translation: BAG61515.1
AC092784 Genomic DNA No translation available.
AC096534 Genomic DNA No translation available.
AC096947 Genomic DNA No translation available.
AC099792 Genomic DNA No translation available.
AL096888 Genomic DNA No translation available.
AL355795 Genomic DNA No translation available.
AL445198 Genomic DNA No translation available.
AL445432 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06601.1
BC022264 mRNA Translation: AAH22264.1
U07809 mRNA Translation: AAA93124.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44156.1 [Q12857-1]
CCDS53321.1 [Q12857-3]
CCDS53322.1 [Q12857-4]
CCDS615.1 [Q12857-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001128145.1, NM_001134673.3 [Q12857-1]
NP_001138983.1, NM_001145511.1 [Q12857-3]
NP_001138984.1, NM_001145512.1 [Q12857-4]
NP_005586.1, NM_005595.4 [Q12857-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371187; ENSP00000360229; ENSG00000162599 [Q12857-2]
ENST00000371189; ENSP00000360231; ENSG00000162599 [Q12857-4]
ENST00000403491; ENSP00000384523; ENSG00000162599 [Q12857-1]
ENST00000407417; ENSP00000384680; ENSG00000162599 [Q12857-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4774

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4774

UCSC genome browser

More...
UCSCi
uc001czv.4 human [Q12857-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037860 mRNA Translation: BAA92677.1 Different initiation.
AK299289 mRNA Translation: BAG61305.1
AK299579 mRNA Translation: BAG61515.1
AC092784 Genomic DNA No translation available.
AC096534 Genomic DNA No translation available.
AC096947 Genomic DNA No translation available.
AC099792 Genomic DNA No translation available.
AL096888 Genomic DNA No translation available.
AL355795 Genomic DNA No translation available.
AL445198 Genomic DNA No translation available.
AL445432 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06601.1
BC022264 mRNA Translation: AAH22264.1
U07809 mRNA Translation: AAA93124.1
CCDSiCCDS44156.1 [Q12857-1]
CCDS53321.1 [Q12857-3]
CCDS53322.1 [Q12857-4]
CCDS615.1 [Q12857-2]
RefSeqiNP_001128145.1, NM_001134673.3 [Q12857-1]
NP_001138983.1, NM_001145511.1 [Q12857-3]
NP_001138984.1, NM_001145512.1 [Q12857-4]
NP_005586.1, NM_005595.4 [Q12857-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi110847, 49 interactors
IntActiQ12857, 13 interactors
MINTiQ12857
STRINGi9606.ENSP00000360231

PTM databases

iPTMnetiQ12857
PhosphoSitePlusiQ12857

Polymorphism and mutation databases

BioMutaiNFIA
DMDMi14194959

Proteomic databases

EPDiQ12857
jPOSTiQ12857
MassIVEiQ12857
MaxQBiQ12857
PaxDbiQ12857
PeptideAtlasiQ12857
PRIDEiQ12857
ProteomicsDBi25418
30217
58986 [Q12857-1]
58987 [Q12857-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4774

Genome annotation databases

EnsembliENST00000371187; ENSP00000360229; ENSG00000162599 [Q12857-2]
ENST00000371189; ENSP00000360231; ENSG00000162599 [Q12857-4]
ENST00000403491; ENSP00000384523; ENSG00000162599 [Q12857-1]
ENST00000407417; ENSP00000384680; ENSG00000162599 [Q12857-3]
GeneIDi4774
KEGGihsa:4774
UCSCiuc001czv.4 human [Q12857-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4774
DisGeNETi4774
EuPathDBiHostDB:ENSG00000162599.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NFIA
HGNCiHGNC:7784 NFIA
HPAiHPA006111
HPA008884
MalaCardsiNFIA
MIMi600727 gene
613735 phenotype
neXtProtiNX_Q12857
OpenTargetsiENSG00000162599
Orphaneti401986 1p31p32 microdeletion syndrome
PharmGKBiPA31590

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3663 Eukaryota
ENOG410Y16G LUCA
GeneTreeiENSGT00950000182916
HOGENOMiHOG000013028
InParanoidiQ12857
KOiK09168
OMAiXSPHATP
OrthoDBi967862at2759
PhylomeDBiQ12857
TreeFamiTF313889

Enzyme and pathway databases

ReactomeiR-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
SIGNORiQ12857

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NFIA human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NFIA

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4774
PharosiQ12857 Tbio

Protein Ontology

More...
PROi
PR:Q12857
RNActiQ12857 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162599 Expressed in 211 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiQ12857 baseline and differential
GenevisibleiQ12857 HS

Family and domain databases

InterProiView protein in InterPro
IPR000647 CTF/NFI
IPR020604 CTF/NFI_DNA-bd-dom
IPR019739 CTF/NFI_DNA-bd_CS
IPR019548 CTF/NFI_DNA-bd_N
IPR003619 MAD_homology1_Dwarfin-type
PANTHERiPTHR11492 PTHR11492, 1 hit
PfamiView protein in Pfam
PF00859 CTF_NFI, 1 hit
PF03165 MH1, 1 hit
PF10524 NfI_DNAbd_pre-N, 1 hit
SMARTiView protein in SMART
SM00523 DWA, 1 hit
PROSITEiView protein in PROSITE
PS00349 CTF_NFI_1, 1 hit
PS51080 CTF_NFI_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFIA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12857
Secondary accession number(s): B4DRJ3
, B4DS53, F5H0R0, F8W8W3, Q8TA97, Q9H3X9, Q9P2A9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: June 1, 2001
Last modified: December 11, 2019
This is version 182 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again