Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tastin

Gene

TROAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.

GO - Biological processi

  • cell adhesion Source: ProtInc

Keywordsi

Biological processCell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Tastin
Alternative name(s):
Trophinin-assisting protein
Trophinin-associated protein
Gene namesi
Name:TROAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000135451.12
HGNCiHGNC:12327 TROAP
MIMi603872 gene
neXtProtiNX_Q12815

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000135451
PharmGKBiPA37003

Polymorphism and mutation databases

BioMutaiTROAP
DMDMi223634724

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000656361 – 778TastinAdd BLAST778

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei16PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Modified residuei324PhosphoserineCombined sources1
Modified residuei334PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei362PhosphoserineCombined sources1
Modified residuei363PhosphothreonineCombined sources1
Modified residuei376PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ12815
MaxQBiQ12815
PaxDbiQ12815
PeptideAtlasiQ12815
PRIDEiQ12815
ProteomicsDBi58966
58967 [Q12815-2]

PTM databases

iPTMnetiQ12815
PhosphoSitePlusiQ12815

Expressioni

Tissue specificityi

Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.

Gene expression databases

BgeeiENSG00000135451 Expressed in 131 organ(s), highest expression level in oocyte
CleanExiHS_TROAP
ExpressionAtlasiQ12815 baseline and differential
GenevisibleiQ12815 HS

Organism-specific databases

HPAiHPA044102

Interactioni

Subunit structurei

Directly binds bystin, and indirectly trophinin.

Binary interactionsi

Protein-protein interaction databases

BioGridi115341, 34 interactors
DIPiDIP-52951N
IntActiQ12815, 26 interactors
MINTiQ12815
STRINGi9606.ENSP00000257909

Structurei

3D structure databases

ProteinModelPortaliQ12815
SMRiQ12815
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati516 – 5481Add BLAST33
Repeati549 – 5812Add BLAST33
Repeati582 – 6143Add BLAST33
Repeati615 – 6474Add BLAST33

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni516 – 6474 X 33 AA approximate tandem repeatsAdd BLAST132

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi504 – 687Cys-richAdd BLAST184

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IVG9 Eukaryota
ENOG41118NJ LUCA
GeneTreeiENSGT00390000012132
HOGENOMiHOG000082520
HOVERGENiHBG063015
InParanoidiQ12815
PhylomeDBiQ12815
TreeFamiTF338049

Family and domain databases

InterProiView protein in InterPro
IPR026133 Tastin
PANTHERiPTHR15289 PTHR15289, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12815-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTRQATKDP LLRGVSPTPS KIPVRSQKRT PFPTVTSCAV DQENQDPRRW
60 70 80 90 100
VQKPPLNIQR PLVDSAGPRP KARHQAETSQ RLVGISQPRN PLEELRPSPR
110 120 130 140 150
GQNVGPGPPA QTEAPGTIEF VADPAALATI LSGEGVKSCH LGRQPSLAKR
160 170 180 190 200
VLVRGSQGGT TQRVQGVRAS AYLAPRTPTH RLDPARASCF SRLEGPGPRG
210 220 230 240 250
RTLCPQRLQA LISPSGPSFH PSTRPSFQEL RRETAGSSRT SVSQASGLLL
260 270 280 290 300
ETPVQPAFSL PKGEREVVTH SDEGGVASLG LAQRVPLREN REMSHTRDSH
310 320 330 340 350
DSHLMPSPAP VAQPLPGHVV PCPSPFGRAQ RVPSPGPPTL TSYSVLRRLT
360 370 380 390 400
VQPKTRFTPM PSTPRVQQAQ WLRGVSPQSC SEDPALPWEQ VAVRLFDQES
410 420 430 440 450
CIRSLEGSGK PPVATPSGPH SNRTPSLQEV KIQRIGILQQ LLRQEVEGLV
460 470 480 490 500
GGQCVPLNGG SSLDMVELQP LLTEISRTLN ATEHNSGTSH LPGLLKHSGL
510 520 530 540 550
PKPCLPEECG EPQPCPPAEP GPPEAFCRSE PEIPEPSLQE QLEVPEPYPP
560 570 580 590 600
AEPRPLESCC RSEPEIPESS RQEQLEVPEP CPPAEPRPLE SYCRIEPEIP
610 620 630 640 650
ESSRQEQLEV PEPCPPAEPG PLQPSTQGQS GPPGPCPRVE LGASEPCTLE
660 670 680 690 700
HRSLESSLPP CCSQWAPATT SLIFSSQHPL CASPPICSLQ SLRPPAGQAG
710 720 730 740 750
LSNLAPRTLA LRERLKSCLT AIHCFHEARL DDECAFYTSR APPSGPTRVC
760 770
TNPVATLLEW QDALCFIPVG SAAPQGSP
Length:778
Mass (Da):83,857
Last modified:February 10, 2009 - v3
Checksum:i530B0481EC8D7E02
GO
Isoform 2 (identifier: Q12815-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: EAPGTIEFVADPAALATILSGEGVKSCHLGRQ → VLVPAPGKLFALRRSPFPPAKCHLARCHGLYL
     145-778: Missing.

Note: No experimental confirmation available.
Show »
Length:144
Mass (Da):15,893
Checksum:i59A5062A4CF71DD2
GO
Isoform 3 (identifier: Q12815-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-778: EAPGTIEFVA...VGSAAPQGSP → GAMACTCNHSYSGG

Note: No experimental confirmation available.
Show »
Length:126
Mass (Da):13,723
Checksum:i644F8AB35FBBD459
GO

Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W130F8W130_HUMAN
Tastin
TROAP
868Annotation score:
B7Z5Q9B7Z5Q9_HUMAN
Tastin
TROAP
158Annotation score:
F8VXV6F8VXV6_HUMAN
Tastin
TROAP
52Annotation score:
F8W1E3F8W1E3_HUMAN
Tastin
TROAP
290Annotation score:
F8W052F8W052_HUMAN
Tastin
TROAP
114Annotation score:
F8VVS4F8VVS4_HUMAN
Tastin
TROAP
180Annotation score:
F8VVT5F8VVT5_HUMAN
Tastin
TROAP
87Annotation score:
F8VXF3F8VXF3_HUMAN
Tastin
TROAP
126Annotation score:
F8W1U0F8W1U0_HUMAN
Tastin
TROAP
457Annotation score:
F8VVX4F8VVX4_HUMAN
Tastin
TROAP
68Annotation score:
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti224R → H in AAA79333 (PubMed:7758945).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055063113 – 778EAPGT…PQGSP → GAMACTCNHSYSGG in isoform 3. 1 PublicationAdd BLAST666
Alternative sequenceiVSP_042820113 – 144EAPGT…HLGRQ → VLVPAPGKLFALRRSPFPPA KCHLARCHGLYL in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_042821145 – 778Missing in isoform 2. 1 PublicationAdd BLAST634

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04810 mRNA Translation: AAA79333.2
AC125611 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58064.1
BC011597 mRNA Translation: AAH11597.1
BC018627 mRNA No translation available.
BC032583 mRNA Translation: AAH32583.1
CCDSiCCDS41779.1 [Q12815-2]
CCDS61117.1 [Q12815-3]
CCDS8784.1 [Q12815-1]
PIRiI38487
RefSeqiNP_001094090.1, NM_001100620.1 [Q12815-2]
NP_001265253.1, NM_001278324.1 [Q12815-3]
NP_005471.3, NM_005480.3 [Q12815-1]
XP_011536027.1, XM_011537725.2
UniGeneiHs.524399

Genome annotation databases

EnsembliENST00000257909; ENSP00000257909; ENSG00000135451 [Q12815-1]
ENST00000380327; ENSP00000369684; ENSG00000135451 [Q12815-2]
ENST00000548311; ENSP00000448313; ENSG00000135451 [Q12815-3]
GeneIDi10024
KEGGihsa:10024
UCSCiuc001rtv.5 human [Q12815-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04810 mRNA Translation: AAA79333.2
AC125611 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58064.1
BC011597 mRNA Translation: AAH11597.1
BC018627 mRNA No translation available.
BC032583 mRNA Translation: AAH32583.1
CCDSiCCDS41779.1 [Q12815-2]
CCDS61117.1 [Q12815-3]
CCDS8784.1 [Q12815-1]
PIRiI38487
RefSeqiNP_001094090.1, NM_001100620.1 [Q12815-2]
NP_001265253.1, NM_001278324.1 [Q12815-3]
NP_005471.3, NM_005480.3 [Q12815-1]
XP_011536027.1, XM_011537725.2
UniGeneiHs.524399

3D structure databases

ProteinModelPortaliQ12815
SMRiQ12815
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115341, 34 interactors
DIPiDIP-52951N
IntActiQ12815, 26 interactors
MINTiQ12815
STRINGi9606.ENSP00000257909

PTM databases

iPTMnetiQ12815
PhosphoSitePlusiQ12815

Polymorphism and mutation databases

BioMutaiTROAP
DMDMi223634724

Proteomic databases

EPDiQ12815
MaxQBiQ12815
PaxDbiQ12815
PeptideAtlasiQ12815
PRIDEiQ12815
ProteomicsDBi58966
58967 [Q12815-2]

Protocols and materials databases

DNASUi10024
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257909; ENSP00000257909; ENSG00000135451 [Q12815-1]
ENST00000380327; ENSP00000369684; ENSG00000135451 [Q12815-2]
ENST00000548311; ENSP00000448313; ENSG00000135451 [Q12815-3]
GeneIDi10024
KEGGihsa:10024
UCSCiuc001rtv.5 human [Q12815-1]

Organism-specific databases

CTDi10024
EuPathDBiHostDB:ENSG00000135451.12
GeneCardsiTROAP
H-InvDBiHIX0010602
HGNCiHGNC:12327 TROAP
HPAiHPA044102
MIMi603872 gene
neXtProtiNX_Q12815
OpenTargetsiENSG00000135451
PharmGKBiPA37003
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVG9 Eukaryota
ENOG41118NJ LUCA
GeneTreeiENSGT00390000012132
HOGENOMiHOG000082520
HOVERGENiHBG063015
InParanoidiQ12815
PhylomeDBiQ12815
TreeFamiTF338049

Miscellaneous databases

ChiTaRSiTROAP human
GeneWikiiTROAP
GenomeRNAii10024
PROiPR:Q12815
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135451 Expressed in 131 organ(s), highest expression level in oocyte
CleanExiHS_TROAP
ExpressionAtlasiQ12815 baseline and differential
GenevisibleiQ12815 HS

Family and domain databases

InterProiView protein in InterPro
IPR026133 Tastin
PANTHERiPTHR15289 PTHR15289, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiTROAP_HUMAN
AccessioniPrimary (citable) accession number: Q12815
Secondary accession number(s): F8VSF9, Q6PJU7, Q8N5B2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 10, 2009
Last modified: October 10, 2018
This is version 139 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again