Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear pore complex protein Nup160

Gene

NUP160

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in poly(A)+ RNA transport.1 Publication

Caution

It is uncertain whether Met-1 or Met-35 is the initiator.Curated

GO - Molecular functioni

  • structural constituent of nuclear pore Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup160
Alternative name(s):
160 kDa nucleoporin
Nucleoporin Nup160
Gene namesi
Name:NUP160
Synonyms:KIAA0197, NUP120
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000030066.13
HGNCiHGNC:18017 NUP160
MIMi607614 gene
neXtProtiNX_Q12769

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23279
OpenTargetsiENSG00000030066
PharmGKBiPA31850

Polymorphism and mutation databases

BioMutaiNUP160
DMDMi238054372

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002048511 – 1436Nuclear pore complex protein Nup160Add BLAST1436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei44PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei949PhosphoserineCombined sources1
Modified residuei1157PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ12769
MaxQBiQ12769
PaxDbiQ12769
PeptideAtlasiQ12769
PRIDEiQ12769
ProteomicsDBi58912
58913 [Q12769-2]
58914 [Q12769-3]

PTM databases

iPTMnetiQ12769
PhosphoSitePlusiQ12769

Expressioni

Gene expression databases

BgeeiENSG00000030066 Expressed in 222 organ(s), highest expression level in oviduct epithelium
CleanExiHS_NUP160
ExpressionAtlasiQ12769 baseline and differential
GenevisibleiQ12769 HS

Interactioni

Subunit structurei

Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ESRRGP625083EBI-295715,EBI-2834260

Protein-protein interaction databases

BioGridi116879, 66 interactors
CORUMiQ12769
DIPiDIP-31262N
IntActiQ12769, 34 interactors
MINTiQ12769
STRINGi9606.ENSP00000367721

Structurei

3D structure databases

ProteinModelPortaliQ12769
SMRiQ12769
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiKOG4521 Eukaryota
ENOG410YYM5 LUCA
GeneTreeiENSGT00390000000972
HOVERGENiHBG052681
InParanoidiQ12769
KOiK14303
OMAiVLCERSQ
OrthoDBiEOG091G02JO
PhylomeDBiQ12769
TreeFamiTF353082

Family and domain databases

InterProiView protein in InterPro
IPR021717 Nucleoporin_Nup160
PANTHERiPTHR21286 PTHR21286, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12769-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLHLSAAPPA PPPEVTATAR PCLCSVGRRG DGGKMAAAGA LERSFVELSG
60 70 80 90 100
AERERPRHFR EFTVCSIGTA NAVAGAVKYS ESAGGFYYVE SGKLFSVTRN
110 120 130 140 150
RFIHWKTSGD TLELMEESLD INLLNNAIRL KFQNCSVLPG GVYVSETQNR
160 170 180 190 200
VIILMLTNQT VHRLLLPHPS RMYRSELVVD SQMQSIFTDI GKVDFTDPCN
210 220 230 240 250
YQLIPAVPGI SPNSTASTAW LSSDGEALFA LPCASGGIFV LKLPPYDIPG
260 270 280 290 300
MVSVVELKQS SVMQRLLTGW MPTAIRGDQS PSDRPLSLAV HCVEHDAFIF
310 320 330 340 350
ALCQDHKLRM WSYKEQMCLM VADMLEYVPV KKDLRLTAGT GHKLRLAYSP
360 370 380 390 400
TMGLYLGIYM HAPKRGQFCI FQLVSTESNR YSLDHISSLF TSQETLIDFA
410 420 430 440 450
LTSTDIWALW HDAENQTVVK YINFEHNVAG QWNPVFMQPL PEEEIVIRDD
460 470 480 490 500
QDPREMYLQS LFTPGQFTNE ALCKALQIFC RGTERNLDLS WSELKKEVTL
510 520 530 540 550
AVENELQGSV TEYEFSQEEF RNLQQEFWCK FYACCLQYQE ALSHPLALHL
560 570 580 590 600
NPHTNMVCLL KKGYLSFLIP SSLVDHLYLL PYENLLTEDE TTISDDVDIA
610 620 630 640 650
RDVICLIKCL RLIEESVTVD MSVIMEMSCY NLQSPEKAAE QILEDMITID
660 670 680 690 700
VENVMEDICS KLQEIRNPIH AIGLLIREMD YETEVEMEKG FNPAQPLNIR
710 720 730 740 750
MNLTQLYGSN TAGYIVCRGV HKIASTRFLI CRDLLILQQL LMRLGDAVIW
760 770 780 790 800
GTGQLFQAQQ DLLHRTAPLL LSYYLIKWGS ECLATDVPLD TLESNLQHLS
810 820 830 840 850
VLELTDSGAL MANRFVSSPQ TIVELFFQEV ARKHIISHLF SQPKAPLSQT
860 870 880 890 900
GLNWPEMITA ITSYLLQLLW PSNPGCLFLE CLMGNCQYVQ LQDYIQLLHP
910 920 930 940 950
WCQVNVGSCR FMLGRCYLVT GEGQKALECF CQAASEVGKE EFLDRLIRSE
960 970 980 990 1000
DGEIVSTPRL QYYDKVLRLL DVIGLPELVI QLATSAITEA GDDWKSQATL
1010 1020 1030 1040 1050
RTCIFKHHLD LGHNSQAYEA LTQIPDSSRQ LDCLRQLVVV LCERSQLQDL
1060 1070 1080 1090 1100
VEFPYVNLHN EVVGIIESRA RAVDLMTHNY YELLYAFHIY RHNYRKAGTV
1110 1120 1130 1140 1150
MFEYGMRLGR EVRTLRGLEK QGNCYLAALN CLRLIRPEYA WIVQPVSGAV
1160 1170 1180 1190 1200
YDRPGASPKR NHDGECTAAP TNRQIEILEL EDLEKECSLA RIRLTLAQHD
1210 1220 1230 1240 1250
PSAVAVAGSS SAEEMVTLLV QAGLFDTAIS LCQTFKLPLT PVFEGLAFKC
1260 1270 1280 1290 1300
IKLQFGGEAA QAEAWAWLAA NQLSSVITTK ESSATDEAWR LLSTYLERYK
1310 1320 1330 1340 1350
VQNNLYHHCV INKLLSHGVP LPNWLINSYK KVDAAELLRL YLNYDLLEEA
1360 1370 1380 1390 1400
VDLVSEYVDA VLGKGHQYFG IEFPLSATAP MVWLPYSSID QLLQALGENS
1410 1420 1430
ANSHNIALSQ KILDKLEDYQ QKVDKATRDL LYRRTL
Length:1,436
Mass (Da):162,121
Last modified:May 26, 2009 - v3
Checksum:i274C063A3CE69F48
GO
Isoform 2 (identifier: Q12769-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK
     225-1436: Missing.

Show »
Length:224
Mass (Da):24,898
Checksum:iC98755EBCB0E1BC7
GO
Isoform 3 (identifier: Q12769-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF
     694-695: AQ → GK
     696-1436: Missing.

Show »
Length:485
Mass (Da):55,554
Checksum:i4650AE42B030DFBC
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V198G3V198_HUMAN
Nuclear pore complex protein Nup160
NUP160
1,314Annotation score:
E9PR16E9PR16_HUMAN
Nuclear pore complex protein Nup160
NUP160
1,123Annotation score:
E9PSI3E9PSI3_HUMAN
Nuclear pore complex protein Nup160
NUP160
102Annotation score:

Sequence cautioni

The sequence AAH09822 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA12110 differs from that shown. Probable cloning artifact. Aberrant splice sites.Curated
The sequence BAB15406 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAG65161 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti152I → K in BAG65161 (PubMed:14702039).Curated1
Sequence conflicti991G → S in BAA12110 (PubMed:8724849).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05540940A → T1 PublicationCorresponds to variant dbSNP:rs2305984Ensembl.1
Natural variantiVAR_055410351T → A1 PublicationCorresponds to variant dbSNP:rs3816605Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0373501 – 250Missing in isoform 3. 1 PublicationAdd BLAST250
Alternative sequenceiVSP_007093175 – 224SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_007094225 – 1436Missing in isoform 2. 2 PublicationsAdd BLAST1212
Alternative sequenceiVSP_037351367Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3. 1 Publication1
Alternative sequenceiVSP_037352694 – 695AQ → GK in isoform 3. 1 Publication2
Alternative sequenceiVSP_037353696 – 1436Missing in isoform 3. 1 PublicationAdd BLAST741

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026236 mRNA Translation: BAB15406.1 Different initiation.
AK302396 mRNA Translation: BAG63710.1
AK304308 mRNA Translation: BAG65161.1 Different initiation.
AC021443 Genomic DNA No translation available.
AC023232 Genomic DNA No translation available.
BC008700 mRNA Translation: AAH08700.1
BC009822 mRNA Translation: AAH09822.1 Different initiation.
BC125227 mRNA Translation: AAI25228.1
BC125228 mRNA Translation: AAI25229.1
D83781 mRNA Translation: BAA12110.1 Sequence problems.
CCDSiCCDS31484.1 [Q12769-1]
CCDS81567.1 [Q12769-2]
PIRiG02870
RefSeqiNP_001305328.1, NM_001318399.1 [Q12769-2]
NP_056046.1, NM_015231.2 [Q12769-1]
UniGeneiHs.643526
Hs.744107

Genome annotation databases

EnsembliENST00000378460; ENSP00000367721; ENSG00000030066 [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066 [Q12769-2]
ENST00000643285; ENSP00000495820; ENSG00000285358 [Q12769-1]
ENST00000645800; ENSP00000496541; ENSG00000285358 [Q12769-2]
GeneIDi23279
KEGGihsa:23279
UCSCiuc001ngm.4 human [Q12769-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026236 mRNA Translation: BAB15406.1 Different initiation.
AK302396 mRNA Translation: BAG63710.1
AK304308 mRNA Translation: BAG65161.1 Different initiation.
AC021443 Genomic DNA No translation available.
AC023232 Genomic DNA No translation available.
BC008700 mRNA Translation: AAH08700.1
BC009822 mRNA Translation: AAH09822.1 Different initiation.
BC125227 mRNA Translation: AAI25228.1
BC125228 mRNA Translation: AAI25229.1
D83781 mRNA Translation: BAA12110.1 Sequence problems.
CCDSiCCDS31484.1 [Q12769-1]
CCDS81567.1 [Q12769-2]
PIRiG02870
RefSeqiNP_001305328.1, NM_001318399.1 [Q12769-2]
NP_056046.1, NM_015231.2 [Q12769-1]
UniGeneiHs.643526
Hs.744107

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5A9Qelectron microscopy23.001/J/S/a1-1436[»]
ProteinModelPortaliQ12769
SMRiQ12769
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116879, 66 interactors
CORUMiQ12769
DIPiDIP-31262N
IntActiQ12769, 34 interactors
MINTiQ12769
STRINGi9606.ENSP00000367721

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

PTM databases

iPTMnetiQ12769
PhosphoSitePlusiQ12769

Polymorphism and mutation databases

BioMutaiNUP160
DMDMi238054372

Proteomic databases

EPDiQ12769
MaxQBiQ12769
PaxDbiQ12769
PeptideAtlasiQ12769
PRIDEiQ12769
ProteomicsDBi58912
58913 [Q12769-2]
58914 [Q12769-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378460; ENSP00000367721; ENSG00000030066 [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066 [Q12769-2]
ENST00000643285; ENSP00000495820; ENSG00000285358 [Q12769-1]
ENST00000645800; ENSP00000496541; ENSG00000285358 [Q12769-2]
GeneIDi23279
KEGGihsa:23279
UCSCiuc001ngm.4 human [Q12769-1]

Organism-specific databases

CTDi23279
DisGeNETi23279
EuPathDBiHostDB:ENSG00000030066.13
GeneCardsiNUP160
H-InvDBiHIX0009624
HGNCiHGNC:18017 NUP160
MIMi607614 gene
neXtProtiNX_Q12769
OpenTargetsiENSG00000030066
PharmGKBiPA31850
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4521 Eukaryota
ENOG410YYM5 LUCA
GeneTreeiENSGT00390000000972
HOVERGENiHBG052681
InParanoidiQ12769
KOiK14303
OMAiVLCERSQ
OrthoDBiEOG091G02JO
PhylomeDBiQ12769
TreeFamiTF353082

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Miscellaneous databases

ChiTaRSiNUP160 human
GeneWikiiNUP160
GenomeRNAii23279
PROiPR:Q12769
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000030066 Expressed in 222 organ(s), highest expression level in oviduct epithelium
CleanExiHS_NUP160
ExpressionAtlasiQ12769 baseline and differential
GenevisibleiQ12769 HS

Family and domain databases

InterProiView protein in InterPro
IPR021717 Nucleoporin_Nup160
PANTHERiPTHR21286 PTHR21286, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNU160_HUMAN
AccessioniPrimary (citable) accession number: Q12769
Secondary accession number(s): B4DYE8
, B4E2J9, Q08AD3, Q7Z5X6, Q96GB3, Q9H660
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 26, 2009
Last modified: October 10, 2018
This is version 183 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again