Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (10 Apr 2019)
Sequence version 3 (26 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Nuclear pore complex protein Nup160

Gene

NUP160

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in poly(A)+ RNA transport.1 Publication

Caution

It is uncertain whether Met-1 or Met-35 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear pore complex protein Nup160
Alternative name(s):
160 kDa nucleoporin
Nucleoporin Nup160
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NUP160
Synonyms:KIAA0197, NUP120
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000030066.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18017 NUP160

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607614 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q12769

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nuclear pore complex, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Nephrotic syndrome 19 (NPHS19)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form that progresses to end-stage renal failure. NPHS19 is an autosomal recessive, steroid-resistant form with onset in the first or second decade of life, resulting in chronic kidney disease.
See also OMIM:618178
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081362803E → K in NPHS19; unknown pathological significance. 1 Publication1
Natural variantiVAR_081363910 – 1436Missing in NPHS19; unknown pathological significance. 1 PublicationAdd BLAST527

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
23279
MIMi618178 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000030066

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31850

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NUP160

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054372

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002048511 – 1436Nuclear pore complex protein Nup160Add BLAST1436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei44PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei949PhosphoserineCombined sources1
Modified residuei1157PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q12769

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q12769

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q12769

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q12769

PeptideAtlas

More...
PeptideAtlasi
Q12769

PRoteomics IDEntifications database

More...
PRIDEi
Q12769

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58912
58913 [Q12769-2]
58914 [Q12769-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q12769

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q12769

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000030066 Expressed in 222 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q12769 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q12769 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ESRRGP625083EBI-295715,EBI-2834260

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116879, 70 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q12769

Database of interacting proteins

More...
DIPi
DIP-31262N

Protein interaction database and analysis system

More...
IntActi
Q12769, 35 interactors

Molecular INTeraction database

More...
MINTi
Q12769

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367721

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5A9Qelectron microscopy23.001/J/S/a1-1436[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q12769

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q12769

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4521 Eukaryota
ENOG410YYM5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000972

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052681

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q12769

KEGG Orthology (KO)

More...
KOi
K14303

Identification of Orthologs from Complete Genome Data

More...
OMAi
VLCERSQ

Database of Orthologous Groups

More...
OrthoDBi
284127at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q12769

TreeFam database of animal gene trees

More...
TreeFami
TF353082

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021717 Nucleoporin_Nup160

The PANTHER Classification System

More...
PANTHERi
PTHR21286 PTHR21286, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q12769-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLHLSAAPPA PPPEVTATAR PCLCSVGRRG DGGKMAAAGA LERSFVELSG
60 70 80 90 100
AERERPRHFR EFTVCSIGTA NAVAGAVKYS ESAGGFYYVE SGKLFSVTRN
110 120 130 140 150
RFIHWKTSGD TLELMEESLD INLLNNAIRL KFQNCSVLPG GVYVSETQNR
160 170 180 190 200
VIILMLTNQT VHRLLLPHPS RMYRSELVVD SQMQSIFTDI GKVDFTDPCN
210 220 230 240 250
YQLIPAVPGI SPNSTASTAW LSSDGEALFA LPCASGGIFV LKLPPYDIPG
260 270 280 290 300
MVSVVELKQS SVMQRLLTGW MPTAIRGDQS PSDRPLSLAV HCVEHDAFIF
310 320 330 340 350
ALCQDHKLRM WSYKEQMCLM VADMLEYVPV KKDLRLTAGT GHKLRLAYSP
360 370 380 390 400
TMGLYLGIYM HAPKRGQFCI FQLVSTESNR YSLDHISSLF TSQETLIDFA
410 420 430 440 450
LTSTDIWALW HDAENQTVVK YINFEHNVAG QWNPVFMQPL PEEEIVIRDD
460 470 480 490 500
QDPREMYLQS LFTPGQFTNE ALCKALQIFC RGTERNLDLS WSELKKEVTL
510 520 530 540 550
AVENELQGSV TEYEFSQEEF RNLQQEFWCK FYACCLQYQE ALSHPLALHL
560 570 580 590 600
NPHTNMVCLL KKGYLSFLIP SSLVDHLYLL PYENLLTEDE TTISDDVDIA
610 620 630 640 650
RDVICLIKCL RLIEESVTVD MSVIMEMSCY NLQSPEKAAE QILEDMITID
660 670 680 690 700
VENVMEDICS KLQEIRNPIH AIGLLIREMD YETEVEMEKG FNPAQPLNIR
710 720 730 740 750
MNLTQLYGSN TAGYIVCRGV HKIASTRFLI CRDLLILQQL LMRLGDAVIW
760 770 780 790 800
GTGQLFQAQQ DLLHRTAPLL LSYYLIKWGS ECLATDVPLD TLESNLQHLS
810 820 830 840 850
VLELTDSGAL MANRFVSSPQ TIVELFFQEV ARKHIISHLF SQPKAPLSQT
860 870 880 890 900
GLNWPEMITA ITSYLLQLLW PSNPGCLFLE CLMGNCQYVQ LQDYIQLLHP
910 920 930 940 950
WCQVNVGSCR FMLGRCYLVT GEGQKALECF CQAASEVGKE EFLDRLIRSE
960 970 980 990 1000
DGEIVSTPRL QYYDKVLRLL DVIGLPELVI QLATSAITEA GDDWKSQATL
1010 1020 1030 1040 1050
RTCIFKHHLD LGHNSQAYEA LTQIPDSSRQ LDCLRQLVVV LCERSQLQDL
1060 1070 1080 1090 1100
VEFPYVNLHN EVVGIIESRA RAVDLMTHNY YELLYAFHIY RHNYRKAGTV
1110 1120 1130 1140 1150
MFEYGMRLGR EVRTLRGLEK QGNCYLAALN CLRLIRPEYA WIVQPVSGAV
1160 1170 1180 1190 1200
YDRPGASPKR NHDGECTAAP TNRQIEILEL EDLEKECSLA RIRLTLAQHD
1210 1220 1230 1240 1250
PSAVAVAGSS SAEEMVTLLV QAGLFDTAIS LCQTFKLPLT PVFEGLAFKC
1260 1270 1280 1290 1300
IKLQFGGEAA QAEAWAWLAA NQLSSVITTK ESSATDEAWR LLSTYLERYK
1310 1320 1330 1340 1350
VQNNLYHHCV INKLLSHGVP LPNWLINSYK KVDAAELLRL YLNYDLLEEA
1360 1370 1380 1390 1400
VDLVSEYVDA VLGKGHQYFG IEFPLSATAP MVWLPYSSID QLLQALGENS
1410 1420 1430
ANSHNIALSQ KILDKLEDYQ QKVDKATRDL LYRRTL
Length:1,436
Mass (Da):162,121
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i274C063A3CE69F48
GO
Isoform 2 (identifier: Q12769-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK
     225-1436: Missing.

Show »
Length:224
Mass (Da):24,898
Checksum:iC98755EBCB0E1BC7
GO
Isoform 3 (identifier: Q12769-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF
     694-695: AQ → GK
     696-1436: Missing.

Show »
Length:485
Mass (Da):55,554
Checksum:i4650AE42B030DFBC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V198G3V198_HUMAN
Nuclear pore complex protein Nup160
NUP160
1,314Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PR16E9PR16_HUMAN
Nuclear pore complex protein Nup160
NUP160
1,123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSI3E9PSI3_HUMAN
Nuclear pore complex protein Nup160
NUP160
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH09822 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA12110 differs from that shown. Probable cloning artifact. Aberrant splice sites.Curated
The sequence BAB15406 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAG65161 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti152I → K in BAG65161 (PubMed:14702039).Curated1
Sequence conflicti991G → S in BAA12110 (PubMed:8724849).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05540940A → T1 PublicationCorresponds to variant dbSNP:rs2305984Ensembl.1
Natural variantiVAR_055410351T → A1 PublicationCorresponds to variant dbSNP:rs3816605Ensembl.1
Natural variantiVAR_081362803E → K in NPHS19; unknown pathological significance. 1 Publication1
Natural variantiVAR_081363910 – 1436Missing in NPHS19; unknown pathological significance. 1 PublicationAdd BLAST527

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0373501 – 250Missing in isoform 3. 1 PublicationAdd BLAST250
Alternative sequenceiVSP_007093175 – 224SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_007094225 – 1436Missing in isoform 2. 2 PublicationsAdd BLAST1212
Alternative sequenceiVSP_037351367Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3. 1 Publication1
Alternative sequenceiVSP_037352694 – 695AQ → GK in isoform 3. 1 Publication2
Alternative sequenceiVSP_037353696 – 1436Missing in isoform 3. 1 PublicationAdd BLAST741

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK026236 mRNA Translation: BAB15406.1 Different initiation.
AK302396 mRNA Translation: BAG63710.1
AK304308 mRNA Translation: BAG65161.1 Different initiation.
AC021443 Genomic DNA No translation available.
AC023232 Genomic DNA No translation available.
BC008700 mRNA Translation: AAH08700.1
BC009822 mRNA Translation: AAH09822.1 Different initiation.
BC125227 mRNA Translation: AAI25228.1
BC125228 mRNA Translation: AAI25229.1
D83781 mRNA Translation: BAA12110.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31484.1 [Q12769-1]
CCDS81567.1 [Q12769-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02870

NCBI Reference Sequences

More...
RefSeqi
NP_001305328.1, NM_001318399.1 [Q12769-2]
NP_056046.1, NM_015231.2 [Q12769-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.643526
Hs.744107

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000378460; ENSP00000367721; ENSG00000030066 [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066 [Q12769-2]
ENST00000643285; ENSP00000495820; ENSG00000285358 [Q12769-1]
ENST00000645800; ENSP00000496541; ENSG00000285358 [Q12769-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23279

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23279

UCSC genome browser

More...
UCSCi
uc001ngm.4 human [Q12769-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026236 mRNA Translation: BAB15406.1 Different initiation.
AK302396 mRNA Translation: BAG63710.1
AK304308 mRNA Translation: BAG65161.1 Different initiation.
AC021443 Genomic DNA No translation available.
AC023232 Genomic DNA No translation available.
BC008700 mRNA Translation: AAH08700.1
BC009822 mRNA Translation: AAH09822.1 Different initiation.
BC125227 mRNA Translation: AAI25228.1
BC125228 mRNA Translation: AAI25229.1
D83781 mRNA Translation: BAA12110.1 Sequence problems.
CCDSiCCDS31484.1 [Q12769-1]
CCDS81567.1 [Q12769-2]
PIRiG02870
RefSeqiNP_001305328.1, NM_001318399.1 [Q12769-2]
NP_056046.1, NM_015231.2 [Q12769-1]
UniGeneiHs.643526
Hs.744107

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5A9Qelectron microscopy23.001/J/S/a1-1436[»]
ProteinModelPortaliQ12769
SMRiQ12769
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116879, 70 interactors
CORUMiQ12769
DIPiDIP-31262N
IntActiQ12769, 35 interactors
MINTiQ12769
STRINGi9606.ENSP00000367721

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

PTM databases

iPTMnetiQ12769
PhosphoSitePlusiQ12769

Polymorphism and mutation databases

BioMutaiNUP160
DMDMi238054372

Proteomic databases

EPDiQ12769
jPOSTiQ12769
MaxQBiQ12769
PaxDbiQ12769
PeptideAtlasiQ12769
PRIDEiQ12769
ProteomicsDBi58912
58913 [Q12769-2]
58914 [Q12769-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378460; ENSP00000367721; ENSG00000030066 [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066 [Q12769-2]
ENST00000643285; ENSP00000495820; ENSG00000285358 [Q12769-1]
ENST00000645800; ENSP00000496541; ENSG00000285358 [Q12769-2]
GeneIDi23279
KEGGihsa:23279
UCSCiuc001ngm.4 human [Q12769-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23279
DisGeNETi23279
EuPathDBiHostDB:ENSG00000030066.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NUP160

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0009624
HGNCiHGNC:18017 NUP160
MIMi607614 gene
618178 phenotype
neXtProtiNX_Q12769
OpenTargetsiENSG00000030066
PharmGKBiPA31850

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4521 Eukaryota
ENOG410YYM5 LUCA
GeneTreeiENSGT00390000000972
HOVERGENiHBG052681
InParanoidiQ12769
KOiK14303
OMAiVLCERSQ
OrthoDBi284127at2759
PhylomeDBiQ12769
TreeFamiTF353082

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232142 SUMOylation of ubiquitinylation proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4085377 SUMOylation of SUMOylation proteins
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NUP160 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NUP160

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23279

Protein Ontology

More...
PROi
PR:Q12769

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000030066 Expressed in 222 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiQ12769 baseline and differential
GenevisibleiQ12769 HS

Family and domain databases

InterProiView protein in InterPro
IPR021717 Nucleoporin_Nup160
PANTHERiPTHR21286 PTHR21286, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNU160_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q12769
Secondary accession number(s): B4DYE8
, B4E2J9, Q08AD3, Q7Z5X6, Q96GB3, Q9H660
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 26, 2009
Last modified: April 10, 2019
This is version 188 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again