Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 99 (29 Sep 2021)
Sequence version 1 (22 Aug 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Protocadherin-15

Gene

Pcdh15

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-dependent cell-adhesion protein. Required for inner ear neuroepithelial cell elaboration and cochlear function. Probably involved in the maintenance of normal retinal function (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protocadherin-15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pcdh15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiGallus gallus (Chicken)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9031 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000539 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini27 – 1376ExtracellularSequence analysisAdd BLAST1350
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1377 – 1397HelicalSequence analysisAdd BLAST21
Topological domaini1398 – 1899CytoplasmicSequence analysisAdd BLAST502

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26Sequence analysisAdd BLAST26
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000042292327 – 1899Protocadherin-15Add BLAST1873

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi32 ↔ 120By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q0ZM14

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In the utricle, localizes to the distal region of the kinocilium and near the tips of the stereocilia.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSGALG00000002744, Expressed in testis and 9 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q0ZM14, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9031.ENSGALP00000004315

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q0ZM14

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini38 – 147Cadherin 1PROSITE-ProRule annotationAdd BLAST110
Domaini148 – 265Cadherin 2PROSITE-ProRule annotationAdd BLAST118
Domaini278 – 395Cadherin 3PROSITE-ProRule annotationAdd BLAST118
Domaini396 – 509Cadherin 4PROSITE-ProRule annotationAdd BLAST114
Domaini510 – 616Cadherin 5PROSITE-ProRule annotationAdd BLAST107
Domaini617 – 717Cadherin 6PROSITE-ProRule annotationAdd BLAST101
Domaini719 – 819Cadherin 7PROSITE-ProRule annotationAdd BLAST101
Domaini820 – 926Cadherin 8PROSITE-ProRule annotationAdd BLAST107
Domaini927 – 1035Cadherin 9PROSITE-ProRule annotationAdd BLAST109
Domaini1037 – 1144Cadherin 10PROSITE-ProRule annotationAdd BLAST108
Domaini1145 – 1259Cadherin 11PROSITE-ProRule annotationAdd BLAST115

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1668 – 1687DisorderedSequence analysisAdd BLAST20
Regioni1700 – 1721DisorderedSequence analysisAdd BLAST22
Regioni1734 – 1820DisorderedSequence analysisAdd BLAST87

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1743 – 1775Pro residuesSequence analysisAdd BLAST33
Compositional biasi1776 – 1795Polar residuesSequence analysisAdd BLAST20
Compositional biasi1801 – 1815Pro residuesSequence analysisAdd BLAST15

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3594, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156675

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001945_0_0_1

Identification of Orthologs from Complete Genome Data

More...
OMAi
DEESRNX

Database of Orthologous Groups

More...
OrthoDBi
21247at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q0ZM14

TreeFam database of animal gene trees

More...
TreeFami
TF326779

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
IPR041149, EC_dom
IPR030718, Protocadherin-15

The PANTHER Classification System

More...
PANTHERi
PTHR24028:SF11, PTHR24028:SF11, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00028, Cadherin, 8 hits
PF18432, ECD, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00205, CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00112, CA, 11 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49313, SSF49313, 10 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00232, CADHERIN_1, 4 hits
PS50268, CADHERIN_2, 10 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (11)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 11 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q0ZM14-1) [UniParc]FASTAAdd to basket
Also known as: CD1-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQQFCLWKW LAVGIAVATI LASSLAQNDE DCKLARTGPP ATIVPIDEES
60 70 80 90 100
RNGTILVDNM LIKGTAAGPD PTIELSLKDN VDYWVILDPI SQRLYLNSTG
110 120 130 140 150
RVLDRDPPMS IQSIVVQVQC VNKKVGTIIN HEVRIVVRDR NDNSPQFQQQ
160 170 180 190 200
RYYVAVNELT PVGTTIFTGF SGNNGATDID DGPNGQIEYV IQYNPNDKTS
210 220 230 240 250
NRTFDIPLTL SGAVVLRERL NYEEKTRYFV IVQANDRAQN LHERRTSTTT
260 270 280 290 300
LTVDVLDGDD LGPMFLPCVL VNNTRDCRPL TYQASLPELT DPVHVNPISV
310 320 330 340 350
TPPIQAIDQD RNIQPPSDRP GILYSILVGT PEDYPQYFHM NLTTAELTLL
360 370 380 390 400
KPINRDLHQK FDLVIKAEQD NGHPLPAFAN LHIEVLDENN QKPYFTKSTY
410 420 430 440 450
EGFILESSPV GTTISDSRNL TSPLQITVLD NDVEETKDPQ LHLFLNDYNT
460 470 480 490 500
FFTVTQSGIT RYLTLLQPVD REAQQLYTFS MIASDGVQES TPVTVNIVVI
510 520 530 540 550
DANDNSPTFS NISYNVKIYT DMGPGEGVIK LTAVDADEGP NGQIVYEILA
560 570 580 590 600
GDQGDFIIND RTGLIAIAPG VVLSVGRSYA LTVKASDSAP PAQRRSSITT
610 620 630 640 650
VYIEVLPPNN QSPPRFPQLM YSLEVSEAMR TGAILLNLQA FDREGDPIRY
660 670 680 690 700
LIENGDPQQV FNLSQSSGLL ALGKPLDRES TDRYILIVTA SDGRPDGTST
710 720 730 740 750
ATVNIVVTDV NDNGPVFDMF LPKNLSVQEE EANAFVGQVR ATDPDAGVNG
760 770 780 790 800
QVHYSLANFK NLFRITSNGS IYTAVKLNRE VRDYYELIVE ATDGAVDPRR
810 820 830 840 850
STLTLAIKVL DIDDNSPVFT NASYSVLVPE NLPPGTVFLQ IEAKDVDLGS
860 870 880 890 900
NVTYRIRTQE ALEYFALNKY TGELSLLKSL DYESFSDTDA TFTFLVEAFD
910 920 930 940 950
SKGTMPPGLA TVTVRVKDMN DYSPVFSKTL YRGMVAPDAV KGTVITTVSA
960 970 980 990 1000
EDQDPPGTPA SRVRYKVDVV QFPYSASIFD VEENSGRVVT RVNLNEEPST
1010 1020 1030 1040 1050
VFKLVVIAYD DGDPVKFNTT TVEIAVLQPS VIPRFTQDEY RPPPVSESAP
1060 1070 1080 1090 1100
KGTVVTVVMA AALNQTIVYS IVSGNEEDVF AINNRTGVIS VKKPLDYERV
1110 1120 1130 1140 1150
TSYELRVQAD SLQVVRSNLR VPSKSNTAKV FIEVKDENDH APVFTKKMYI
1160 1170 1180 1190 1200
GGVSEDAKMF SSVLKVKADD KDTGNYSAMQ YRLIIPPIKD GKEGFVIEAY
1210 1220 1230 1240 1250
TGLIKTAMLF KNMRRSYFKF QVIATDDYGK GLSSKADVLV SVVNQLDMQV
1260 1270 1280 1290 1300
IVSNVPPTLV EQNKDQLIGI LERYVQDQIP GATVVVESIG ARRFGDGYSE
1310 1320 1330 1340 1350
EDYTKSDLMV YAIDPQTNRA IMRNELFKFL DGKLLDINKE FQPYLGQGGR
1360 1370 1380 1390 1400
ILEIRTPDVV ANVKKQAQAV GYTEGALLAL AVIIILCCMP AILIVMVSYR
1410 1420 1430 1440 1450
QRQAECAKTA RIQMALPAGK PASTAANNLY EELGDSTILF LLYHFQQSRG
1460 1470 1480 1490 1500
KKSVLEEGDR QRVISSFASR AIEAHKQSNI NGSLNNNLPK SSSNITFLSD
1510 1520 1530 1540 1550
ENPLTTQNPL YVEGVTQSPA AAGLLRKRSD ALDTLSPMQL VLRDASLGGS
1560 1570 1580 1590 1600
HRAWTVPAHV TKRHAPGSLS RPVIMDPVQW QQERLKAENE GTENQHSRVD
1610 1620 1630 1640 1650
ISSPLFQKIS GPTLTVKEKA RQFEQQALQE MKQVKSPDVK STRSPTHSIC
1660 1670 1680 1690 1700
LQERDNTLEQ SPKSVFASPC LRSSPLSSPT PCEVVEPEPS AVPSVIITHH
1710 1720 1730 1740 1750
DYPEELSPPP TRKPTPPSFR IKKPVCQSFL APQTKGEVTE NIPDPPKTPP
1760 1770 1780 1790 1800
PPPPLLPPPP PSPPLLPPHP PTLPLASVPS SSSLPSTQHL SPAKHSKSPA
1810 1820 1830 1840 1850
KQPAVPPPAA VPEPPPRREL KGILKNIQNL AAIEKSVANM YSQIDKNHVL
1860 1870 1880 1890
PKHISKLKPV ATPELPTPEA AAEHNQQNGN LSCVVEELEK RFPSQSTAL
Length:1,899
Mass (Da):209,146
Last modified:August 22, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAE7CD4A078E9B31B
GO
Isoform 2 (identifier: Q0ZM14-2) [UniParc]FASTAAdd to basket
Also known as: CD1-2

The sequence of this isoform differs from the canonical sequence as follows:
     199-232: TSNRTFDIPLTLSGAVVLRERLNYEEKTRYFVIV → SFSSLPFPTKQGKKVSLRRRRSAESYKQLCFPCY
     233-1899: Missing.

Show »
Length:232
Mass (Da):25,880
Checksum:i4FF5F7B9F2B40835
GO
Isoform 3 (identifier: Q0ZM14-3) [UniParc]FASTAAdd to basket
Also known as: CD2/3-1

The sequence of this isoform differs from the canonical sequence as follows:
     1438-1899: ILFLLYHFQQ...KRFPSQSTAL → MRGYAQQEQQ...NNLHIPMTKL

Show »
Length:2,192
Mass (Da):241,067
Checksum:i58096DFBC6E6F546
GO
Isoform 4 (identifier: Q0ZM14-4) [UniParc]FASTAAdd to basket
Also known as: CD3-1

The sequence of this isoform differs from the canonical sequence as follows:
     1438-1899: ILFLLYHFQQ...KRFPSQSTAL → MRGYAQQEQQ...NNLHIPMTKL

Show »
Length:1,710
Mass (Da):189,468
Checksum:i1A5B71111BFE2E4C
GO
Isoform 5 (identifier: Q0ZM14-5) [UniParc]FASTAAdd to basket
Also known as: CD3-2

The sequence of this isoform differs from the canonical sequence as follows:
     367-618: AEQDNGHPLP...NNQSPPRFPQ → ELSMESGIDP...NNLHIPMTKL
     619-1899: Missing.

Show »
Length:618
Mass (Da):69,190
Checksum:i9724C2A9AE869322
GO
Isoform 6 (identifier: Q0ZM14-6) [UniParc]FASTAAdd to basket
Also known as: CD3-3

The sequence of this isoform differs from the canonical sequence as follows:
     294-302: HVNPISVTP → PRWQTAGYQ
     303-1899: Missing.

Show »
Length:302
Mass (Da):33,754
Checksum:iD865EB11E34F6751
GO
Isoform 7 (identifier: Q0ZM14-7) [UniParc]FASTAAdd to basket
Also known as: CD3-4

The sequence of this isoform differs from the canonical sequence as follows:
     293-384: VHVNPISVTP...LPAFANLHIE → NVPLNTLSKG...NNLHIPMTKL
     385-1899: Missing.

Show »
Length:384
Mass (Da):42,621
Checksum:i11B50616D5CA3D5B
GO
Isoform 8 (identifier: Q0ZM14-8) [UniParc]FASTAAdd to basket
Also known as: CD3-5

The sequence of this isoform differs from the canonical sequence as follows:
     199-381: TSNRTFDIPL...GHPLPAFANL → WARKKRIKLI...NNLHIPMTKL
     382-1899: Missing.

Show »
Length:381
Mass (Da):42,160
Checksum:iEA956E087B0FDBD4
GO
Isoform 9 (identifier: Q0ZM14-9) [UniParc]FASTAAdd to basket
Also known as: CD3-6

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: D → E
     107-1269: Missing.
     1438-1899: ILFLLYHFQQ...KRFPSQSTAL → MRGYAQQEQQ...NNLHIPMTKL

Show »
Length:547
Mass (Da):60,887
Checksum:i0C362AA544127CFC
GO
Isoform 10 (identifier: Q0ZM14-10) [UniParc]FASTAAdd to basket
Also known as: CD3-7

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: L → V
     160-1899: Missing.

Show »
Length:159
Mass (Da):17,774
Checksum:iF6618933A309EC30
GO
Isoform 11 (identifier: Q0ZM14-11) [UniParc]FASTAAdd to basket
Also known as: CD3-8

The sequence of this isoform differs from the canonical sequence as follows:
     107-107: P → V
     108-1899: Missing.

Show »
Length:107
Mass (Da):11,754
Checksum:iC767B0DC6E504764
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABC79291 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence ABC79292 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047419106D → E in isoform 9. 1 Publication1
Alternative sequenceiVSP_047420107 – 1269Missing in isoform 9. 1 PublicationAdd BLAST1163
Alternative sequenceiVSP_047421107P → V in isoform 11. 1 Publication1
Alternative sequenceiVSP_047422108 – 1899Missing in isoform 11. 1 PublicationAdd BLAST1792
Alternative sequenceiVSP_047423159L → V in isoform 10. 1 Publication1
Alternative sequenceiVSP_047424160 – 1899Missing in isoform 10. 1 PublicationAdd BLAST1740
Alternative sequenceiVSP_047425199 – 381TSNRT…AFANL → WARKKRIKLIVDPEYETSST GEDSAPDSSQRSRLNNPNIQ NNVNGNIYIAQNGSVVRTRR VCLANNLKVTSPVTLGKQFK KLDKLAVTHEENVPLNTLSK GSSSSDKVNTRPCSVSFASS IGAENIVTKPGGSKMKSTEE QESVVDNEDTKEPLESHSEH TQSDEEELWMGPWNNLHIPM TKL in isoform 8. 1 PublicationAdd BLAST183
Alternative sequenceiVSP_047426199 – 232TSNRT…YFVIV → SFSSLPFPTKQGKKVSLRRR RSAESYKQLCFPCY in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_047427233 – 1899Missing in isoform 2. 1 PublicationAdd BLAST1667
Alternative sequenceiVSP_047428293 – 384VHVNP…NLHIE → NVPLNTLSKGSSSSDKVNTR PCSVSFASSIGAENIVTKPG GSKMKSTEEQESVVDNEDTK EPLESHSEHTQSDEEELWMG PWNNLHIPMTKL in isoform 7. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_047429294 – 302HVNPISVTP → PRWQTAGYQ in isoform 6. 1 Publication9
Alternative sequenceiVSP_047430303 – 1899Missing in isoform 6. 1 PublicationAdd BLAST1597
Alternative sequenceiVSP_047431367 – 618AEQDN…PRFPQ → ELSMESGIDPGQEYYGQDYY SYEHGYELPQYGSRRRLLSP SGMYDEYGEVMVENDGGYYY SPHGSTAEEWARKKRIKLIV DPEYETSSTGEDSAPDSSQR SRLNNPNIQNNVNGNIYIAQ NGSVVRTRRVCLANNLKVTS PVTLGKQFKKLDKLAVTHEE NVPLNTLSKGSSSSDKVNTR PCSVSFASSIGAENIVTKPG GSKMKSTEEQESVVDNEDTK EPLESHSEHTQSDEEELWMG PWNNLHIPMTKL in isoform 5. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_047432382 – 1899Missing in isoform 8. 1 PublicationAdd BLAST1518
Alternative sequenceiVSP_047433385 – 1899Missing in isoform 7. 1 PublicationAdd BLAST1515
Alternative sequenceiVSP_047434619 – 1899Missing in isoform 5. 1 PublicationAdd BLAST1281
Alternative sequenceiVSP_0474351438 – 1899ILFLL…QSTAL → MRGYAQQEQQQLLRPSLLRP EELSMESGIDPGQEYYGQDY YSYEHGYELPQYGSRRRLLS PSGMYDEYGEVMVENDGGYY YSPHGSTAEEGMSQSRGPSS RGISQRAGAQIEGRPLDGGM DLRHGSGRAYRTSQGRRKLK AVMHLSRVAVSAHKPVGRSE SAHSPWKKAKIFPMILQKVK GSRKDSSYAKLMSARQADGE KSMIIRGSYFQKSTDDRPSM RKLNHVLKRISVSRKFQEPT SKDAVHLGGKEEEERDEAKS GVSISITAESEHEESDYEKK KKRRRKYSSDESSAKSSSSG SESEDKDYLTVTLDQDEATE STVDSDEESGHDIGDSDDGS GSSSSSESEEDSSEEDSDEE ESDSDEDDSLSQSSSTQSSF SKSGTSESSSRRSTGRSSTK SRGSSSRGRARRSSQKSVSS NTSGASCRKTSGSSYKSKTS SASLEIEDTIEEVSEEDEQA DAEQVGASPDETIDNTKNKT VSKTSANAKSAKNAATEEDK RRKSGVNSGDNGDESAEEVD TDASDKEETVSKNGSEISVT SKGTGGIKSTASATSGRTAT SPDTETQSSDINWARKKRIK LIVDPEYETSSTGEDSAPDS SQRSRLNNPNIQNNVNGNIY IAQNGSVVRTRRVCLANNLK VTSPVTLGKQFKKLDKLAVT HEENVPLNTLSKGSSSSDKV NTRPCSVSFASSIGAENIVT KPGGSKMKSTEEQESVVDNE DTKEPLESHSEHTQSDEEEL WMGPWNNLHIPMTKL in isoform 3. 1 PublicationAdd BLAST462
Alternative sequenceiVSP_0474361438 – 1899ILFLL…QSTAL → MRGYAQQEQQQLLRPSLLRP EELSMESGIDPGQEYYGQDY YSYEHGYELPQYGSRRRLLS PSGMYDEYGEVMVENDGGYY YSPHGSTAEEWARKKRIKLI VDPEYETSSTGEDSAPDSSQ RSRLNNPNIQNNVNGNIYIA QNGSVVRTRRVCLANNLKVT SPVTLGKQFKKLDKLAVTHE ENVPLNTLSKGSSSSDKVNT RPCSVSFASSIGAENIVTKP GGSKMKSTEEQESVVDNEDT KEPLESHSEHTQSDEEELWM GPWNNLHIPMTKL in isoform 4 and isoform 9. 1 PublicationAdd BLAST462

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ354419 mRNA Translation: ABC79282.1
DQ354420 mRNA Translation: ABC79283.1
DQ354421 mRNA Translation: ABC79284.1
DQ354422 mRNA Translation: ABC79285.1
DQ354423 mRNA Translation: ABC79286.1
DQ354424 mRNA Translation: ABC79287.1
DQ354425 mRNA Translation: ABC79288.1
DQ354426 mRNA Translation: ABC79289.1
DQ354427 mRNA Translation: ABC79290.1
DQ354428 mRNA Translation: ABC79291.1 Sequence problems.
DQ354429 mRNA Translation: ABC79292.1 Sequence problems.
AADN03005146 Genomic DNA No translation available.
AADN02035256 Genomic DNA No translation available.
AADN02035257 Genomic DNA No translation available.
AADN02035258 Genomic DNA No translation available.

NCBI Reference Sequences

More...
RefSeqi
NP_001038119.1, NM_001044654.1 [Q0ZM14-3]
XP_015143569.1, XM_015288083.1 [Q0ZM14-1]
XP_015143573.1, XM_015288087.1 [Q0ZM14-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSGALT00000004324; ENSGALP00000004315; ENSGALG00000002744 [Q0ZM14-3]
ENSGALT00000044134; ENSGALP00000040727; ENSGALG00000002744 [Q0ZM14-1]
ENSGALT00000085003; ENSGALP00000060369; ENSGALG00000002744 [Q0ZM14-2]
ENSGALT00000086118; ENSGALP00000058882; ENSGALG00000002744 [Q0ZM14-8]
ENSGALT00000087430; ENSGALP00000060700; ENSGALG00000002744 [Q0ZM14-4]
ENSGALT00000088076; ENSGALP00000059801; ENSGALG00000002744 [Q0ZM14-5]
ENSGALT00000106410; ENSGALP00000071651; ENSGALG00000002744 [Q0ZM14-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
423644

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
gga:423644

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ354419 mRNA Translation: ABC79282.1
DQ354420 mRNA Translation: ABC79283.1
DQ354421 mRNA Translation: ABC79284.1
DQ354422 mRNA Translation: ABC79285.1
DQ354423 mRNA Translation: ABC79286.1
DQ354424 mRNA Translation: ABC79287.1
DQ354425 mRNA Translation: ABC79288.1
DQ354426 mRNA Translation: ABC79289.1
DQ354427 mRNA Translation: ABC79290.1
DQ354428 mRNA Translation: ABC79291.1 Sequence problems.
DQ354429 mRNA Translation: ABC79292.1 Sequence problems.
AADN03005146 Genomic DNA No translation available.
AADN02035256 Genomic DNA No translation available.
AADN02035257 Genomic DNA No translation available.
AADN02035258 Genomic DNA No translation available.
RefSeqiNP_001038119.1, NM_001044654.1 [Q0ZM14-3]
XP_015143569.1, XM_015288083.1 [Q0ZM14-1]
XP_015143573.1, XM_015288087.1 [Q0ZM14-4]

3D structure databases

SMRiQ0ZM14
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000004315

Proteomic databases

PaxDbiQ0ZM14

Genome annotation databases

EnsembliENSGALT00000004324; ENSGALP00000004315; ENSGALG00000002744 [Q0ZM14-3]
ENSGALT00000044134; ENSGALP00000040727; ENSGALG00000002744 [Q0ZM14-1]
ENSGALT00000085003; ENSGALP00000060369; ENSGALG00000002744 [Q0ZM14-2]
ENSGALT00000086118; ENSGALP00000058882; ENSGALG00000002744 [Q0ZM14-8]
ENSGALT00000087430; ENSGALP00000060700; ENSGALG00000002744 [Q0ZM14-4]
ENSGALT00000088076; ENSGALP00000059801; ENSGALG00000002744 [Q0ZM14-5]
ENSGALT00000106410; ENSGALP00000071651; ENSGALG00000002744 [Q0ZM14-7]
GeneIDi423644
KEGGigga:423644

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65217

Phylogenomic databases

eggNOGiKOG3594, Eukaryota
GeneTreeiENSGT00940000156675
HOGENOMiCLU_001945_0_0_1
OMAiDEESRNX
OrthoDBi21247at2759
PhylomeDBiQ0ZM14
TreeFamiTF326779

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q0ZM14

Gene expression databases

BgeeiENSGALG00000002744, Expressed in testis and 9 other tissues
ExpressionAtlasiQ0ZM14, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
IPR041149, EC_dom
IPR030718, Protocadherin-15
PANTHERiPTHR24028:SF11, PTHR24028:SF11, 1 hit
PfamiView protein in Pfam
PF00028, Cadherin, 8 hits
PF18432, ECD, 1 hit
PRINTSiPR00205, CADHERIN
SMARTiView protein in SMART
SM00112, CA, 11 hits
SUPFAMiSSF49313, SSF49313, 10 hits
PROSITEiView protein in PROSITE
PS00232, CADHERIN_1, 4 hits
PS50268, CADHERIN_2, 10 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCD15_CHICK
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q0ZM14
Secondary accession number(s): F1N8B3
, Q0ZM04, Q0ZM05, Q0ZM06, Q0ZM07, Q0ZM08, Q0ZM09, Q0ZM10, Q0ZM11, Q0ZM12, Q0ZM13
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2013
Last sequence update: August 22, 2006
Last modified: September 29, 2021
This is version 99 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again