Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 94 (02 Dec 2020)
Sequence version 4 (08 Mar 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Coiled-coil domain-containing protein 162

Gene

Ccdc162

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 162Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ccdc162Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1923223, Ccdc162

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003072981 – 912Coiled-coil domain-containing protein 162Add BLAST912

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q0VG85

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q0VG85

PRoteomics IDEntifications database

More...
PRIDEi
Q0VG85

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q0VG85

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q0VG85

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000075225, Expressed in pancreas and 85 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q0VG85, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000135966

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q0VG85, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q0VG85

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1 – 35Sequence analysisAdd BLAST35
Coiled coili220 – 276Sequence analysisAdd BLAST57

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRID, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000165946

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007479_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q0VG85

Database of Orthologous Groups

More...
OrthoDBi
54096at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q0VG85

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040401, CCDC162

The PANTHER Classification System

More...
PANTHERi
PTHR33331, PTHR33331, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 5 (identifier: Q0VG85-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFKSLPEEEA FRALTLTLQL VASLHDIVAY TFSFAKLGNC PACFDLPLSP
60 70 80 90 100
NPLMRDWGGA EGIGNELQEL QKMIDSLQRP QDPSQVAQAL LLRREVTLLQ
110 120 130 140 150
FDAAMRHLLR TFLAAGNAPA YQSVAESACY GLPPLSNALG KSIFSSQLSL
160 170 180 190 200
PQPLDPWSPQ AFALFPWRAF LEDGGPFPVI SSVPDTLEYD MQMCLCGLSD
210 220 230 240 250
CDRRVAHGEL VGVQMLMEDV LLGSCHVIRK ASTEWQAALD NAQPDWSKLP
260 270 280 290 300
GLYPNQLESH PKASALLEGQ CDVVMSLSLL KSFLILWKRL EVLKEHWGRF
310 320 330 340 350
KLRGQDINSA LLHRQFSELY EAEILYPSMK ALARQMGKED EFEELMLRSQ
360 370 380 390 400
SILPPKGASE IEIKTQQLQK LLESLEIHMI QEVLRKVNRE MTLFLSEKSK
410 420 430 440 450
EESTLPTDRW KHQVMKENFS VMRPQIVERF VQRLMEDSQD DGPKITFRRE
460 470 480 490 500
HLEACILSLG CDVMARERSN FETYSMCYEH ILQHTRQKLS QKEQEVDLLR
510 520 530 540 550
RSQVPSEDCA GQVAELSHDM IMEITALRAQ LTDLEEENLN LKIQIRKEVQ
560 570 580 590 600
EEYRELVQAL FLTCLRIKEK LDENQFNLIQ KVCELIGEVR AEGIANVKQL
610 620 630 640 650
KKTWGSARPD EETKENTAKE QLCALEQDHS STLAALLCKA RSLGRWRLAV
660 670 680 690 700
QQAHLRGQLS RAEMESILSK KECLRIKLMA EQEAALLHQQ LLAARQALTK
710 720 730 740 750
AQTDNRKLWR QNDTQAQLLR ELEHRVTQDS VTRQQLDIIK TSGMEKLLKD
760 770 780 790 800
VEQKEQKLQL LTEEAERASK RGQLQQKKMD RDLKQMRNRL AQERSVKLDA
810 820 830 840 850
FQRVQELQSQ LYDIQWPSVQ MGSPVGLRSQ THCSLSSAST LSRHPHHHFS
860 870 880 890 900
KTHFVGSKMT RRIQRPKTVP VKHNRRIEDG SLPSVKENVQ LTTFQAQTAP
910
SGISFRPESF SS
Length:912
Mass (Da):104,336
Last modified:March 8, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2648B9CF22555833
GO
Isoform 2 (identifier: Q0VG85-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-519: Missing.
     620-664: Missing.
     786-822: MRNRLAQERSVKLDAFQRVQELQSQLYDIQWPSVQMG → VRAADPDLKGLRSQLSMEQLFPGLSVPLTAFSLLCQF
     823-912: Missing.

Show »
Length:258
Mass (Da):29,890
Checksum:iA06887AA2C9CF7BA
GO
Isoform 3 (identifier: Q0VG85-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-707: Missing.
     708-715: LWRQNDTQ → MKESHIRK

Show »
Length:205
Mass (Da):23,745
Checksum:iDAE76738F1661A5B
GO
Isoform 4 (identifier: Q0VG85-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDSVYKFSST...IPHPSEVLFM

Show »
Length:2,185
Mass (Da):249,323
Checksum:i3B0128844DE63905
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BX79H7BX79_MOUSE
Coiled-coil domain-containing prote...
Ccdc162
722Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G8JL71G8JL71_MOUSE
Coiled-coil domain-containing prote...
Ccdc162
463Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6T8A0A1W2P6T8_MOUSE
Coiled-coil domain-containing prote...
Ccdc162
912Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1ST15A0A1L1ST15_MOUSE
Coiled-coil domain-containing prote...
Ccdc162
595Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0406881 – 707Missing in isoform 3. 1 PublicationAdd BLAST707
Alternative sequenceiVSP_0406871 – 519Missing in isoform 2. 1 PublicationAdd BLAST519
Alternative sequenceiVSP_0590011M → MDSVYKFSSTERIVLLEKEL AVKLSELKTEVEDQGLFPGT GNRIFSSVQIPKDVAHFRRE REAALKRTLQVAESKPLVIQ ADVLKRELESCLRREYTPEN LPLLLLQYYTERITQLGQSK YLHVLRWKRLCQTSMAMEEL YPLYKKQVDYIMQEFNDSVQ RAERLSVARENLLMGKNNRP DLVTQEDLAIYTRWLVCHLH ALRTIHHFLQALQYLPISRV LSLAAKQVSGSSEEDGKACV TDLHAASPGPLGPHVSGSGR TDAAFVLPQHVTDRDDLKPQ LRRLLSHFHIPDDVQKLSDS AKEMGLFSSVSQNFQSIFME QQRMWTFPDYEAGRGNVQNP TMSGPTTTLRKRADWIPFVK VKPKCDPWQKKMLTRLKERK RIDELMNLQSQFLKISDPVR VMQVLQDHAAKTVPMASNHP SRPPAQPLHPRNYDQVWKNI YSNPKLYQAENPSDDDFAKP HLSQSSDGSLKQRTETGYNF AVALQLLGLSDGTEPDRNPV LMRGAYLSFLCLRHLHIREL QRICLGVLNFFRSVERTLTM NTSGLTLVSGTLVPTLGDSS WINMSKGGMGTLQGLGTHHY IHGTPAEHKVHSIQFLEFSE AENQDDFHTTQAGYVHTQDQ LGEYVVYDSALQDLKELESE LLLIASHYIEKEKSHRGECR SEGSQLLGWAHANVDRFAVL YDLWTCETNLLEGKRQLLDS YFEAYQHTLDPEERFALAQA MTDIMHRRPKFDLSHSYFTK AYRDDCTCLRLHLQLVRGIL SHHLEQQRDYVQRLWRGDHP EAPKTFGLPLNVICKQFVSI SNSCPASGKVHPLELHPSLG LAGLIPKALEHLFREARHAH KAASPSSLAQIEICSLQLAL DLWLSPVKPEAWYSAQLQRE LFSAQVMGDPFLMEEVGLLA LRSAVDKGVKQGQDFHTLLL DTFSRLLELLTLRHRLIETS VESAYLAGLYKELALEMGFE ESHLHLRPVHFEFASHKDKV DPPPPVFITSLLEDSSRVDR YCPTSLVLAISELDDNQIGK FSFHTKEAILKLFVHSGVEN MQVTLACQTAQRNALMVAIQ QAFFYHIPGAGSLVDLKETS SDPRHHGGVSPCRRDSRTTN GKECLLLTPTLKTPDTFTHS SGFKTSKRAPEAFVSIQLEK AGLRDLMLNTFLHRKQTMMD QIKSPDDVEKVKKELIVEYC QKLNRRMSHYSLRGQIMAYC NSLRVLLDDFPTIRNTFFMV GQPNEKKGLKDSSGELKADS SRSFQPRPRSLLSADGRVFL NLWFIPHPSEVLFM in isoform 4. 1
Alternative sequenceiVSP_040690620 – 664Missing in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_040689708 – 715LWRQNDTQ → MKESHIRK in isoform 3. 1 Publication8
Alternative sequenceiVSP_040691786 – 822MRNRL…SVQMG → VRAADPDLKGLRSQLSMEQL FPGLSVPLTAFSLLCQF in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_040692823 – 912Missing in isoform 2. 1 PublicationAdd BLAST90

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK050292 mRNA Translation: BAE20670.1
AK137750 mRNA Translation: BAE23488.1
AC132290 Genomic DNA No translation available.
AC161426 Genomic DNA No translation available.
BC112401 mRNA Translation: AAI12402.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56700.3 [Q0VG85-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001290398.1, NM_001303469.1
XP_006512962.1, XM_006512899.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000019955; ENSMUSP00000019955; ENSMUSG00000075225 [Q0VG85-2]
ENSMUST00000189488; ENSMUSP00000140774; ENSMUSG00000075225 [Q0VG85-6]

UCSC genome browser

More...
UCSCi
uc007exw.2, mouse [Q0VG85-5]
uc007exx.1, mouse [Q0VG85-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK050292 mRNA Translation: BAE20670.1
AK137750 mRNA Translation: BAE23488.1
AC132290 Genomic DNA No translation available.
AC161426 Genomic DNA No translation available.
BC112401 mRNA Translation: AAI12402.2
CCDSiCCDS56700.3 [Q0VG85-6]
RefSeqiNP_001290398.1, NM_001303469.1
XP_006512962.1, XM_006512899.3

3D structure databases

SMRiQ0VG85
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000135966

PTM databases

iPTMnetiQ0VG85
PhosphoSitePlusiQ0VG85

Proteomic databases

MaxQBiQ0VG85
PaxDbiQ0VG85
PRIDEiQ0VG85

Genome annotation databases

EnsembliENSMUST00000019955; ENSMUSP00000019955; ENSMUSG00000075225 [Q0VG85-2]
ENSMUST00000189488; ENSMUSP00000140774; ENSMUSG00000075225 [Q0VG85-6]
UCSCiuc007exw.2, mouse [Q0VG85-5]
uc007exx.1, mouse [Q0VG85-2]

Organism-specific databases

MGIiMGI:1923223, Ccdc162

Phylogenomic databases

eggNOGiENOG502QRID, Eukaryota
GeneTreeiENSGT00940000165946
HOGENOMiCLU_007479_0_0_1
InParanoidiQ0VG85
OrthoDBi54096at2759
PhylomeDBiQ0VG85

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
75973, 0 hits in 8 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ccdc162, mouse

Protein Ontology

More...
PROi
PR:Q0VG85
RNActiQ0VG85, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000075225, Expressed in pancreas and 85 other tissues
GenevisibleiQ0VG85, MM

Family and domain databases

InterProiView protein in InterPro
IPR040401, CCDC162
PANTHERiPTHR33331, PTHR33331, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC162_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q0VG85
Secondary accession number(s): A0A087WRU3, Q3UUY5, Q3V339
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 8, 2011
Last modified: December 2, 2020
This is version 94 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again