Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (17 Jun 2020)
Sequence version 3 (30 Nov 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Fanconi anemia core complex-associated protein 100

Gene

FAAP100

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in Fanconi anemia-associated DNA damage response network. Regulates FANCD2 monoubiquitination and the stability of the FA core complex. Induces chromosomal instability as well as hypersensitivity to DNA cross-linking agents, when repressed.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processDNA damage, DNA repair

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6783310 Fanconi Anemia Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fanconi anemia core complex-associated protein 1001 PublicationImported
Alternative name(s):
Fanconi anemia-associated protein of 100 kDa
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAAP1001 PublicationImported
Synonyms:C17orf70
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000185504.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26171 FAAP100

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611301 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q0VG06

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000185504

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672253

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q0VG06 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAAP100

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104237

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002891301 – 881Fanconi anemia core complex-associated protein 100Add BLAST881

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei667PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-3224
CPTAC-3225

Encyclopedia of Proteome Dynamics

More...
EPDi
Q0VG06

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q0VG06

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q0VG06

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q0VG06

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q0VG06

PeptideAtlas

More...
PeptideAtlasi
Q0VG06

PRoteomics IDEntifications database

More...
PRIDEi
Q0VG06

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
58837 [Q0VG06-1]
58838 [Q0VG06-2]
58839 [Q0VG06-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q0VG06-1 [Q0VG06-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q0VG06

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q0VG06

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185504 Expressed in right hemisphere of cerebellum and 157 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q0VG06 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q0VG06 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000185504 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Belongs to the multisubunit FA complex composed of FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL/PHF9, FANCM, FAAP24 and FAAP100.

Forms a subcomplex with FANCB and FANCL.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123196, 48 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q0VG06

Protein interaction database and analysis system

More...
IntActi
Q0VG06, 30 interactors

Molecular INTeraction database

More...
MINTi
Q0VG06

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000333283

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q0VG06 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q0VG06

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEYW Eukaryota
ENOG410YKI3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016682

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018470_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q0VG06

KEGG Orthology (KO)

More...
KOi
K10993

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQLFERP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q0VG06

TreeFam database of animal gene trees

More...
TreeFami
TF330817

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029251 Faap100

The PANTHER Classification System

More...
PANTHERi
PTHR14890 PTHR14890, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15146 FANCAA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q0VG06-1) [UniParc]FASTAAdd to basket
Also known as: b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGAAPRVRY LAGFCCPLGG LAAGKPRVLC HEAEVFLSTG SELVYVYDQE
60 70 80 90 100
GGLLTAAFRF PDQVWHLELL APRRLLYALC ARRGLYCLSL DHPGRSRSTS
110 120 130 140 150
QDDRDSEDGD QPSPVIPVDP DACILPDAAL CAFTLLDSVL VTLVQGPARW
160 170 180 190 200
KMQLFEQPCP GEDPRPGGQI GEVELSSYTP PAGVPGKPAA PHFLPVLCSV
210 220 230 240 250
SPSGSRVPHD LLGGSGGFTL EDALFGLLFG ADATLLQSPV VLCGLPDGQL
260 270 280 290 300
CCVILKALVT SRSAPGDPNA LVKILHHLEE PVIFIGALKT EPQAAEAAEN
310 320 330 340 350
FLPDEDVHCD CLVAFGHHGR MLAIKASWDE SGKLVPELRE YCLPGPVLCA
360 370 380 390 400
ACGGGGRVYH STPSDLCVVD LSRGSTPLGP EQPEEGPGGL PPMLCPASLN
410 420 430 440 450
ICSVVSLSAS PRTHEGGTKL LALSAKGRLM TCSLDLDSEM PGPARMTTES
460 470 480 490 500
AGQKIKELLS GIGNISERVS FLKKAVDQRN KALTSLNEAM NVSCALLSSG
510 520 530 540 550
TGPRPISCTT STTWSRLQTQ DVLMATCVLE NSSSFSLDQG WTLCIQVLTS
560 570 580 590 600
SCALDLDSAC SAITYTIPVD QLGPGARREV TLPLGPGENG GLDLPVTVSC
610 620 630 640 650
TLFYSLREVV GGALAPSDSE DPFLDECPSD VLPEQEGVCL PLSRHTVDML
660 670 680 690 700
QCLRFPGLAP PHTRAPSPLG PTRDPVATFL ETCREPGSQP AGPASLRAEY
710 720 730 740 750
LPPSVASIKV SAELLRAALK DGHSGVPLCC ATLQWLLAEN AAVDVVRARA
760 770 780 790 800
LSSIQGVAPD GANVHLIVRE VAMTDLCPAG PIQAVEIQVE SSSLADICRA
810 820 830 840 850
HHAVVGRMQT MVTEQATQGS SAPDLRVQYL RQIHANHETL LREVQTLRDR
860 870 880
LCTEDEASSC ATAQRLLQVY RQLRHPSLIL L
Length:881
Mass (Da):93,433
Last modified:November 30, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC586768FB1C7ABD2
GO
Isoform 2 (identifier: Q0VG06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-628: Missing.
     629-665: SDVLPEQEGVCLPLSRHTVDMLQCLRFPGLAPPHTRA → MPASFPMLRCARSPCWTVCWSPWCRALPDGRCSCLSS

Show »
Length:253
Mass (Da):27,379
Checksum:i2E7DDEE936B426BA
GO
Isoform 3 (identifier: Q0VG06-3) [UniParc]FASTAAdd to basket
Also known as: a

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.

Show »
Length:730
Mass (Da):77,050
Checksum:i74F9837F3C90F630
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EVV8E7EVV8_HUMAN
Fanconi anemia core complex-associa...
FAAP100
530Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5G6F5H5G6_HUMAN
Fanconi anemia core complex-associa...
FAAP100
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GZS4F5GZS4_HUMAN
Fanconi anemia core complex-associa...
FAAP100
249Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H095F5H095_HUMAN
Fanconi anemia core complex-associa...
FAAP100
300Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2L9I3L2L9_HUMAN
Fanconi anemia core complex-associa...
FAAP100
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KQD8J3KQD8_HUMAN
Fanconi anemia core complex-associa...
FAAP100
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH21968 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB15251 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAD39037 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti654R → C in BC008883 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032582660P → L2 PublicationsCorresponds to variant dbSNP:rs11552304Ensembl.1
Natural variantiVAR_032583817T → A2 PublicationsCorresponds to variant dbSNP:rs14422Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0259221 – 628Missing in isoform 2. 1 PublicationAdd BLAST628
Alternative sequenceiVSP_0382621 – 151Missing in isoform 3. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_025923629 – 665SDVLP…PHTRA → MPASFPMLRCARSPCWTVCW SPWCRALPDGRCSCLSS in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK024644 mRNA Translation: BAB14944.1
AK025828 mRNA Translation: BAB15251.1 Different initiation.
AC137896 Genomic DNA No translation available.
CR978826 mRNA No translation available.
BC001724 mRNA Translation: AAH01724.1
BC008883 mRNA No translation available.
BC021968 mRNA Translation: AAH21968.1 Different initiation.
BC117139 mRNA Translation: AAI17140.1
BC117141 mRNA Translation: AAI17142.1
AL834374 mRNA Translation: CAD39037.2 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32765.2 [Q0VG06-1]

NCBI Reference Sequences

More...
RefSeqi
NP_079437.5, NM_025161.5 [Q0VG06-1]
XP_006722175.1, XM_006722112.3 [Q0VG06-3]
XP_016880651.1, XM_017025162.1 [Q0VG06-3]
XP_016880652.1, XM_017025163.1 [Q0VG06-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000327787; ENSP00000333283; ENSG00000185504 [Q0VG06-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80233

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80233

UCSC genome browser

More...
UCSCi
uc002kaq.4 human [Q0VG06-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024644 mRNA Translation: BAB14944.1
AK025828 mRNA Translation: BAB15251.1 Different initiation.
AC137896 Genomic DNA No translation available.
CR978826 mRNA No translation available.
BC001724 mRNA Translation: AAH01724.1
BC008883 mRNA No translation available.
BC021968 mRNA Translation: AAH21968.1 Different initiation.
BC117139 mRNA Translation: AAI17140.1
BC117141 mRNA Translation: AAI17142.1
AL834374 mRNA Translation: CAD39037.2 Different initiation.
CCDSiCCDS32765.2 [Q0VG06-1]
RefSeqiNP_079437.5, NM_025161.5 [Q0VG06-1]
XP_006722175.1, XM_006722112.3 [Q0VG06-3]
XP_016880651.1, XM_017025162.1 [Q0VG06-3]
XP_016880652.1, XM_017025163.1 [Q0VG06-3]

3D structure databases

SMRiQ0VG06
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123196, 48 interactors
CORUMiQ0VG06
IntActiQ0VG06, 30 interactors
MINTiQ0VG06
STRINGi9606.ENSP00000333283

PTM databases

iPTMnetiQ0VG06
PhosphoSitePlusiQ0VG06

Polymorphism and mutation databases

BioMutaiFAAP100
DMDMi313104237

Proteomic databases

CPTACiCPTAC-3224
CPTAC-3225
EPDiQ0VG06
jPOSTiQ0VG06
MassIVEiQ0VG06
MaxQBiQ0VG06
PaxDbiQ0VG06
PeptideAtlasiQ0VG06
PRIDEiQ0VG06
ProteomicsDBi58837 [Q0VG06-1]
58838 [Q0VG06-2]
58839 [Q0VG06-3]
TopDownProteomicsiQ0VG06-1 [Q0VG06-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
19824 62 antibodies

The DNASU plasmid repository

More...
DNASUi
80233

Genome annotation databases

EnsembliENST00000327787; ENSP00000333283; ENSG00000185504 [Q0VG06-1]
GeneIDi80233
KEGGihsa:80233
UCSCiuc002kaq.4 human [Q0VG06-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80233
EuPathDBiHostDB:ENSG00000185504.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAAP100
HGNCiHGNC:26171 FAAP100
HPAiENSG00000185504 Low tissue specificity
MIMi611301 gene
neXtProtiNX_Q0VG06
OpenTargetsiENSG00000185504
PharmGKBiPA142672253

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEYW Eukaryota
ENOG410YKI3 LUCA
GeneTreeiENSGT00390000016682
HOGENOMiCLU_018470_0_0_1
InParanoidiQ0VG06
KOiK10993
OMAiMQLFERP
PhylomeDBiQ0VG06
TreeFamiTF330817

Enzyme and pathway databases

ReactomeiR-HSA-6783310 Fanconi Anemia Pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
80233 53 hits in 789 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAAP100 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80233
PharosiQ0VG06 Tdark

Protein Ontology

More...
PROi
PR:Q0VG06
RNActiQ0VG06 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185504 Expressed in right hemisphere of cerebellum and 157 other tissues
ExpressionAtlasiQ0VG06 baseline and differential
GenevisibleiQ0VG06 HS

Family and domain databases

InterProiView protein in InterPro
IPR029251 Faap100
PANTHERiPTHR14890 PTHR14890, 1 hit
PfamiView protein in Pfam
PF15146 FANCAA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFP100_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q0VG06
Secondary accession number(s): A6NNM1
, Q8N3F7, Q9BV13, Q9H6K7, Q9H7E8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: November 30, 2010
Last modified: June 17, 2020
This is version 121 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again