Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (02 Jun 2021)
Sequence version 3 (26 Feb 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Dynein axonemal heavy chain 14

Gene

DNAH14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity).

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi1164 – 1171ATPSequence analysis8
Nucleotide bindingi1427 – 1434ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q0VDD8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dynein axonemal heavy chain 14
Alternative name(s):
Axonemal beta dynein heavy chain 14
Ciliary dynein heavy chain 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAH14
Synonyms:C1orf67
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2945, DNAH14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603341, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q0VDD8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000185842.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
127602

Open Targets

More...
OpenTargetsi
ENSG00000185842

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27399

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q0VDD8, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DNAH14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172046085

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002865601 – 3507Dynein axonemal heavy chain 14Add BLAST3507

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi1818N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q0VDD8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q0VDD8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q0VDD8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q0VDD8

PeptideAtlas

More...
PeptideAtlasi
Q0VDD8

PRoteomics IDEntifications database

More...
PRIDEi
Q0VDD8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
58820 [Q0VDD8-1]
58821 [Q0VDD8-2]
58822 [Q0VDD8-3]
58823 [Q0VDD8-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q0VDD8, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q0VDD8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q0VDD8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185842, Expressed in intestine and 133 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q0VDD8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q0VDD8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000185842, Tissue enhanced (pituitary gland, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126070, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q0VDD8, 10 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q0VDD8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q0VDD8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni91 – 126DisorderedSequence analysisAdd BLAST36

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili354 – 381Sequence analysisAdd BLAST28

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1164 – 1171GPAGTGKT motifBy similarity8

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160505

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000038_6_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q0VDD8

Identification of Orthologs from Complete Genome Data

More...
OMAi
CLSFLMS

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q0VDD8

TreeFam database of animal gene trees

More...
TreeFami
TF342240

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.8.710, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035699, AAA_6
IPR035706, AAA_9
IPR026980, DNAH6/14
IPR043157, Dynein_AAA1S
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR46454:SF6, PTHR46454:SF6, 6 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12774, AAA_6, 2 hits
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 2 hits
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF12777, MT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q0VDD8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRRSQWIWA MRCQMLVPVL SLHIGLARAL GCGCIASKIE CLIRCNAPFP
60 70 80 90 100
LLDAVGSVAS QELQSLTGTV GVTSGAAAYP RWNLARARAP PHLPGTQDPL
110 120 130 140 150
RRVRDPTPIV ASSPGRRRGS WSGGYGQEAS EPGVVGLCCA VLPIHPSLAL
160 170 180 190 200
AGVGGPDLRR FQEGPQRPSD HGAAEKHMET FIPIDLTTEN QEMDKEETKT
210 220 230 240 250
KPRLLRYEEK KYEDVKPLET QPAEIAEKET LEYKTVRTFS ESLKSEKTEE
260 270 280 290 300
PKDDDVIRNI IRLREKLGWQ TILPQHSLKY GSSKIAIQKI TLKKPLEDDG
310 320 330 340 350
EFVYCLPRKS PKSLYNPYDL QVVSAHTAKH CKEFWVITAS FISKLDSSRT
360 370 380 390 400
YSLDEFCEEQ LQQATQALKQ LEDIRNKAIS EMKSTFLKVA EKNEIKEYFE
410 420 430 440 450
SKLSEDDTTH FKLPKYRRLL ETFFKFVMLV DYIFQELIRQ LMNTAVTLLL
460 470 480 490 500
ELFNGSAGMP FSVEKKNENL IRTFKDNSFP TGKTTNDCEE LVDNSKLHAI
510 520 530 540 550
SVQKSEVKTD TDINEILNSV EVGKDLRKTY APIFEVNLCL RIPAESDSSE
560 570 580 590 600
NSKENFHESD QCPEECVMFE DEMSENKDNC VKKHSSEELL PKAKKSKEIS
610 620 630 640 650
YNLEDIISAT ITPLCQDPQL SIFIDLVSIM DLPNKTGSII HYKEQTRWPD
660 670 680 690 700
CHILFETDPA YQNIIVNLLT IIGNSMGLVN AYSHKFIKYC TMTEKAKIMS
710 720 730 740 750
MKISSMGELT SKEFEAILNR FRNYFRHIVN MAIEKRIGIF NVVVESSLQQ
760 770 780 790 800
LECDPTEIEE FLEHFIFLNA ISSKISKLEK EFLTMSQLYS VAKHHQIHIS
810 820 830 840 850
EEQIAIFQVL LLKFSQLKSS MKLSKINKDT AITKFRDNLE ACISGLHVDV
860 870 880 890 900
GNLKAKIRTP LLLCAGTQVS TAMEMIQTLS GEAASLTNKA KAYSHYQDCF
910 920 930 940 950
SDSQSHMHSV NVEEITQIVL SEISDIEGDL TLRKKLWEAQ EEWKRASWEW
960 970 980 990 1000
RNSSLQSIDV ESVQRNVSKL MHIISVLEKE IYSIFIIPSI DDISAQLEES
1010 1020 1030 1040 1050
QVILATIKGS PHIGPIKSQI MFYNDCVKSF VSSYSREKLE KVHAGLMCHL
1060 1070 1080 1090 1100
EEVADLVVLD TSNSRTKAIL GALLILYVHC RDIVINLLLK NIFNAEDFEW
1110 1120 1130 1140 1150
TRHLQYKWNE KQKLCYVSQG NASFTYGYEY LGCTSRLVIT PLTDRCWLTL
1160 1170 1180 1190 1200
MEALHLNLGG CPAGPAGTGK TETVKDLAKC ALFAFKCNTA LIKLPNSLIV
1210 1220 1230 1240 1250
LTCFGLEKTV LVMNTVMSFR FVLEGKEIRI NMSCAVFITM NPRYGGGVEL
1260 1270 1280 1290 1300
PDNLKSLFRP VAMMVPHYQM IAEIILFSFG FKSANSLSGK LTNLYELARK
1310 1320 1330 1340 1350
QLSQQDHYNF GLRSLKIVLI MAGTKKREFK CDTSDSLSEA DETLIVIEAI
1360 1370 1380 1390 1400
REASLPKCPP EDVPLFENII GDIFPEVTVL KVNQLALEKV IYTATQQLGL
1410 1420 1430 1440 1450
QNWSSQKEKI IQFYNQLQVC VGVMLVGPTG GGKTTVRRIL EKALTLLPIA
1460 1470 1480 1490 1500
DFLSVAERKS ASKISERKGK VDICVLNPKC VTLSELYGQL DPNTMEWTDG
1510 1520 1530 1540 1550
LLSATIRSYV YFNTPKNTKK DIDLRLKSRI SDLSNVFKLD SSDTTETDDN
1560 1570 1580 1590 1600
IFEEIEKVVK IPENHNFDWQ WIILDGPVDT FWVENLNSVL DDTRTLCLAN
1610 1620 1630 1640 1650
SERIALTNKI RVIFEVDNLS QASPATVSRC AMVYMDPVDL GWEPYVKSWL
1660 1670 1680 1690 1700
LKTSKIISQS GVDCLEFMIK NSVTDGLQFI RNRQKFQPYP MEDITVVITL
1710 1720 1730 1740 1750
CRILDAFFDF MGKNGGFEQS DDLNDTSSKE ANSQRESVTF KDIEKRDENT
1760 1770 1780 1790 1800
WYPEKNPDKL TKIIQKLFVF AFTWAFGGAL NREDEHRENI PFCPSLEPDS
1810 1820 1830 1840 1850
LAKVTYDFDK LVHELFGNSS QVGINLPTGE CSIFGYFVDI EQCEFIPWSD
1860 1870 1880 1890 1900
LVPNDQTLIQ RDNPTKKPEV RTNKKLLKNN DHKGVVVSTI NFSTNVTAAK
1910 1920 1930 1940 1950
TKEMILKKLI RRTKDTLGAP KNNRILIFID DMNMPVSDMY GAQPPLELIR
1960 1970 1980 1990 2000
QLLDLGGVYD TEKNTWKNIQ DLSIVAACVP VVNDISPRLL KHFSMLVLPH
2010 2020 2030 2040 2050
PSQDILCTIF QIGIDGCGKK TCATLACYLT DNKLYRVPIS HKCAYIEFKE
2060 2070 2080 2090 2100
VFKKVFIHAG LKGKPTVLMV PNLNIEQDSF LEDLNYIISS GRIPDLFENV
2110 2120 2130 2140 2150
ELDSIAMKIR YLTEQSGHMD NRQSLLSFFQ KRIYKNLHIF VIMSPEGPSF
2160 2170 2180 2190 2200
RQNCRVYPSM ISSCTIDWYE RWPEEALLIV ANSFLKEKVN FENRENLKEK
2210 2220 2230 2240 2250
LAPTCVQIHK SMKDLNRKYF EETGRFYYTT PNSYLQFMET FAHILRAREE
2260 2270 2280 2290 2300
EMQTKRDRFH MGLSTILEAT TLVTEMQEEL LILGPQVEQK TKETETLMEK
2310 2320 2330 2340 2350
LRKDSQVVEK VQMLVKQDEE IVAEEVRIVE DYAQKTANEL KSVLPAFDKA
2360 2370 2380 2390 2400
IVALNALDKA DVAELRVYTR PPFLVLTVMN AVCILLQKKP NWATAKLLLS
2410 2420 2430 2440 2450
ETGFLKKLIN LDKDSIPDKV FVKLKKIVTL PDFNPHKISL VSVACCSLCQ
2460 2470 2480 2490 2500
WVIALNNYHE VQKVVGPKQI QVAEAQNVLK IARQRLAEKQ RGLQLISRWH
2510 2520 2530 2540 2550
NQGLPHGQYS VENAILIKNG QQWPLLIDPH RQAHKWIRQM EGSRLQKLSI
2560 2570 2580 2590 2600
EDSNYTKKIE NAMKTGGSVL LQSCQASTWR KKLYLSTEID NPHFLPSVYN
2610 2620 2630 2640 2650
FVTMINFTVT FQGLQDQLLS TVVTHEVPHL EDQRSKLLES ISLDAITLEE
2660 2670 2680 2690 2700
LEEKTLNLLQ KALGSILDDD KIVDTLRKSK MTSNEISKRI EATKKAESEI
2710 2720 2730 2740 2750
QAIRKNYLPI ATRGALLYFL VADLTQINYM YQFSLDWFHQ VFVSSVVSKS
2760 2770 2780 2790 2800
KEQEHSFKRE KVSPKEVHEF ISISKEPNLE NEKNLLDKHI KSAIDMLTKS
2810 2820 2830 2840 2850
IFKVVSSALF NEDKLCFSFR LCTVIMQNNA NGNLIQDDIG FLPEEEWNIF
2860 2870 2880 2890 2900
LYSGILINIK SALSQSRLTS TFEIGESQHL QWLSDSRWRQ CQYVSTHLEP
2910 2920 2930 2940 2950
FSLLCKSLLS NVSQWDTFKN SKAVYSLIST PFSSENASLE ENTKPPEEKH
2960 2970 2980 2990 3000
TFCLLLRAIN HTGTDLGPVG RGQWLTSTAC DRHTDVCSFS FALNDGVPDV
3010 3020 3030 3040 3050
EHVQDIFYGH CVDKYHVKVL RPESLNNSVR KFITEKMGNK YLQRTGVNLK
3060 3070 3080 3090 3100
DAYKGSNART PLILIQTHGS ASIKDYIHII QSLPDDDLPE VLGIHPEAIR
3110 3120 3130 3140 3150
SCWETQGEKF IENLIAMQPK TTTANLMIRP EQSKDELVME ILSDLLKRLP
3160 3170 3180 3190 3200
LTVEKEEIAV GTPSTLKSMM SSSIWESLSK NLKDHDPLIH CVLLTFLKQE
3210 3220 3230 3240 3250
IKRFDKLLFV IHKSLKDLQL AIKGEIILTQ ELEEIFNSFL NMRVPTLWQK
3260 3270 3280 3290 3300
HAYRSCKPLS SWIDDLIQRL NFFNTWAKVA YTAIQRRYMR FVTVWKQSIP
3310 3320 3330 3340 3350
STSQKCKHPE DSENNFFEGF PSRYWLPAFF FPQAFLAAVL QDYGRSRGIA
3360 3370 3380 3390 3400
VDALTFTHHV ISNTTDKDEK FSVFMPKKLN IVRRAFKGSA SSHTGVYIFG
3410 3420 3430 3440 3450
LFIEGARWNR EQKILEDSLP LEMCCDFPDI YFLPTKISTK TPNASNQTDS
3460 3470 3480 3490 3500
ELYAFECPVY QTPERSRILA TTGLPTNFLT SVYLSTKKPP SHWITMRVAL

LCEKNEK
Length:3,507
Mass (Da):399,895
Last modified:February 26, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF0471356846EEA9
GO
Isoform 2 (identifier: Q0VDD8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     473-3507: Missing.

Show »
Length:453
Mass (Da):53,464
Checksum:i4FCBD670CE50E236
GO
Isoform 3 (identifier: Q0VDD8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     345-355: LDSSRTYSLDE → RYLVICGAVYI
     356-3507: Missing.

Show »
Length:228
Mass (Da):26,682
Checksum:iB038A7FB9772243D
GO
Isoform 4 (identifier: Q0VDD8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     609-609: A → DTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCIT
     744-744: V → SLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVV
     979-979: K → KGLPKSDMVT...TPLPLILHHT
     1017-1017: K → KDLVNEWDQN...YIYNIILLFQ
     1180-1219: CALFAFKCNT...VLVMNTVMSF → SLGKHCVVFN...IKAAKDNYSA
     1332-1336: Missing.
     1823-1823: G → GWKHWGQSQGRRRKGNC
     1861-1861: R → RGTSLLTNLQ...ETHKTATGSS
     2011-2011: Q → QAHLGIYFSI...LSRELENCFQ
     2495-2495: L → LVEEHLLFLQ...LIKVMAQKYE
     2573-2582: SCQASTWRKK → NLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFR
     2949-3016: KHTFCLLLRA...FYGHCVDKYH → TELLNENKETCNPINFPWEKLTSFQRLIL
     3069-3069: G → GIDLTNILLR...VLKDDFSFSR

Show »
Length:4,515
Mass (Da):518,565
Checksum:iF59EF01CCCED2401
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXS7H7BXS7_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
1,481Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PR53A0A1W2PR53_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
1,477Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9KV43H9KV43_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBI3H0YBI3_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C164H7C164_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
299Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3Z3H7C3Z3_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MMK7M9MMK7_HUMAN
Dynein heavy chain 14, axonemal
DNAH14 hCG_22803
430Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C374H7C374_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBB1H0YBB1_HUMAN
Dynein heavy chain 14, axonemal
DNAH14
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI19717 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI19718 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW69735 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti424F → L in AAI19718 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032116220T → S1 PublicationCorresponds to variant dbSNP:rs41267347Ensembl.1
Natural variantiVAR_032117274P → L1 PublicationCorresponds to variant dbSNP:rs41267349Ensembl.1
Natural variantiVAR_0577642671K → E. Corresponds to variant dbSNP:rs6667999Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0313141 – 177Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST177
Alternative sequenceiVSP_031315249E → EDYLRESIIQQHMVSPEPAS LKEKGKSRRKKDQTHACPNV RKARPVSYDRT in isoform 2, isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_031316344K → KVINIVGSVKEVELIPTLEW LSERRHYYLLRQFKIFSDFR MNKAFVTWKLNVKRIKTEKS RSFLYHHLFLADDLFQTCLV YIRGLCEDAINLKNYNDHEN NLSAICLVK in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_038241345 – 355LDSSRTYSLDE → RYLVICGAVYI in isoform 3. CuratedAdd BLAST11
Alternative sequenceiVSP_038242356 – 3507Missing in isoform 3. CuratedAdd BLAST3152
Alternative sequenceiVSP_031317473 – 3507Missing in isoform 2. 1 PublicationAdd BLAST3035
Alternative sequenceiVSP_038243609A → DTEIETEFENKYMYYEFPEF PTNLFIDPNRLEFSVKIQNM LTNMEKCIT in isoform 4. Curated1
Alternative sequenceiVSP_038244744V → SLDYQSECLLYIDNVIHMSH TLIQSVIEKKNKNLLEVV in isoform 4. Curated1
Alternative sequenceiVSP_038245979K → KGLPKSDMVTHLKQVVTEFK QELPIIIALGNPCLKPRHWE ALQEIIGKSVPLDKNCKVEN LLALKMFQYENEINDMSTSA TNEAALEKMLFKIIDFWNTT PLPLILHHT in isoform 4. Curated1
Alternative sequenceiVSP_0382461017K → KDLVNEWDQNLTLFSYTLEE WMNCQRNWLYLEPVFHSSEI RRQLPAETELFSQVISMWKK IMSKIQNKQNALQITTSAGV LEILQNCNIHLEHIKKSLED YLEVKRLIFPRFYFLSNAEL LDILADSRNPESVQPHLVKC FENIKQLLIWKQDIGPPAVK MLISAEGEGLVLPKKIRVRS AVEQWLVNVEKSMFDVLKKE RYIYNIILLFQ in isoform 4. Curated1
Alternative sequenceiVSP_0382471180 – 1219CALFA…TVMSF → SLGKHCVVFNCFEDLDYKIV RKFFFGLVQSGAWSCFDEFN LIDLEVLSVIASQILTIKAA KDNYSA in isoform 4. CuratedAdd BLAST40
Alternative sequenceiVSP_0382481332 – 1336Missing in isoform 4. Curated5
Alternative sequenceiVSP_0382491823G → GWKHWGQSQGRRRKGNC in isoform 4. Curated1
Alternative sequenceiVSP_0382501861R → RGTSLLTNLQRSGGNFLKIT ECGECINYTATRDTTCLSFL MSLLLKNSCPVLLTGESGVG KTAAINQMLEKLEGPGAFDI KHGSILGDTLLYSEIKKSSS LKQNITILIPETHKTATGSS in isoform 4. Curated1
Alternative sequenceiVSP_0382512011Q → QAHLGIYFSINNFTPEVQKS KDQIISCSLAIYHQVRQNML PTPTKCHYMFNLRDMFKLLL GLLQADRTVVNSKEMAALLF VHEATRVFHDRLIDFTDKSL FYRLLSRELENCFQ in isoform 4. Curated1
Alternative sequenceiVSP_0382522495L → LVEEHLLFLQAAYKDTVAEK QLLANRKTMASRRFQCASVL LTVLEDEKTRWQETINQIDN KLEGILGDILLSAACIVYSG ILTPEFRQLIVNKWETFCIE NGISLSSKFSLIKVMAQKYE in isoform 4. Curated1
Alternative sequenceiVSP_0382532573 – 2582SCQASTWRKK → NLLETLAPGLKAILKKDIYQ KKGHYFIRVGDAEFEYNSNF R in isoform 4. Curated10
Alternative sequenceiVSP_0382542949 – 3016KHTFC…VDKYH → TELLNENKETCNPINFPWEK LTSFQRLIL in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_0382553069G → GIDLTNILLRFAQELKGTTH HVTIISLGRDQAAKAEDLIL KALTKTQQWVFLQNCHLATS FMPRLCTIVESFNSPNVTID PEFRLWLSSKSYSSFPIPVL KKGLKIAVESPQGLKSNLLQ TFGCTGSGEVTEEIFENPDC GQWWKKLLFSLCFFNAVINE RKNYGILGWNIAYKFNSSDL GVAIKVLENSLRGQPSISWQ ALRYLIGEVIYGGRVIDNWD KRCLKTLLYKFCNPEVLKDD FSFSR in isoform 4. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC093560 Genomic DNA No translation available.
AL590547 Genomic DNA No translation available.
AL596134 Genomic DNA No translation available.
AL645769 Genomic DNA No translation available.
AC092811 Genomic DNA No translation available.
AL162738 Genomic DNA No translation available.
AL357912 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW69735.1 Sequence problems.
BC119716 mRNA Translation: AAI19717.1 Different initiation.
BC119717 mRNA Translation: AAI19718.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41472.1 [Q0VDD8-3]
CCDS44322.1 [Q0VDD8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138626.1, NM_001145154.1 [Q0VDD8-2]
NP_001364.1, NM_001373.1
NP_659426.2, NM_144989.2 [Q0VDD8-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000366848; ENSP00000355813; ENSG00000185842 [Q0VDD8-3]
ENST00000366850; ENSP00000355815; ENSG00000185842 [Q0VDD8-3]
ENST00000400952; ENSP00000383737; ENSG00000185842 [Q0VDD8-2]
ENST00000430092; ENSP00000414402; ENSG00000185842 [Q0VDD8-4]
ENST00000439375; ENSP00000392061; ENSG00000185842 [Q0VDD8-4]
ENST00000445597; ENSP00000409472; ENSG00000185842 [Q0VDD8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
127602

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:127602

UCSC genome browser

More...
UCSCi
uc001hou.5, human [Q0VDD8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC093560 Genomic DNA No translation available.
AL590547 Genomic DNA No translation available.
AL596134 Genomic DNA No translation available.
AL645769 Genomic DNA No translation available.
AC092811 Genomic DNA No translation available.
AL162738 Genomic DNA No translation available.
AL357912 Genomic DNA No translation available.
CH471098 Genomic DNA Translation: EAW69735.1 Sequence problems.
BC119716 mRNA Translation: AAI19717.1 Different initiation.
BC119717 mRNA Translation: AAI19718.1 Different initiation.
CCDSiCCDS41472.1 [Q0VDD8-3]
CCDS44322.1 [Q0VDD8-2]
RefSeqiNP_001138626.1, NM_001145154.1 [Q0VDD8-2]
NP_001364.1, NM_001373.1
NP_659426.2, NM_144989.2 [Q0VDD8-3]

3D structure databases

SMRiQ0VDD8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126070, 18 interactors
IntActiQ0VDD8, 10 interactors

PTM databases

GlyGeniQ0VDD8, 1 site
iPTMnetiQ0VDD8
PhosphoSitePlusiQ0VDD8

Genetic variation databases

BioMutaiDNAH14
DMDMi172046085

Proteomic databases

EPDiQ0VDD8
jPOSTiQ0VDD8
MassIVEiQ0VDD8
MaxQBiQ0VDD8
PeptideAtlasiQ0VDD8
PRIDEiQ0VDD8
ProteomicsDBi58820 [Q0VDD8-1]
58821 [Q0VDD8-2]
58822 [Q0VDD8-3]
58823 [Q0VDD8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34641, 76 antibodies

The DNASU plasmid repository

More...
DNASUi
127602

Genome annotation databases

EnsembliENST00000366848; ENSP00000355813; ENSG00000185842 [Q0VDD8-3]
ENST00000366850; ENSP00000355815; ENSG00000185842 [Q0VDD8-3]
ENST00000400952; ENSP00000383737; ENSG00000185842 [Q0VDD8-2]
ENST00000430092; ENSP00000414402; ENSG00000185842 [Q0VDD8-4]
ENST00000439375; ENSP00000392061; ENSG00000185842 [Q0VDD8-4]
ENST00000445597; ENSP00000409472; ENSG00000185842 [Q0VDD8-1]
GeneIDi127602
KEGGihsa:127602
UCSCiuc001hou.5, human [Q0VDD8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
127602
DisGeNETi127602

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAH14
HGNCiHGNC:2945, DNAH14
HPAiENSG00000185842, Tissue enhanced (pituitary gland, testis)
MIMi603341, gene
neXtProtiNX_Q0VDD8
OpenTargetsiENSG00000185842
PharmGKBiPA27399
VEuPathDBiHostDB:ENSG00000185842.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000160505
HOGENOMiCLU_000038_6_0_1
InParanoidiQ0VDD8
OMAiCLSFLMS
OrthoDBi1318335at2759
PhylomeDBiQ0VDD8
TreeFamiTF342240

Enzyme and pathway databases

PathwayCommonsiQ0VDD8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
127602, 5 hits in 994 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DNAH14, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
127602
PharosiQ0VDD8, Tdark

Protein Ontology

More...
PROi
PR:Q0VDD8
RNActiQ0VDD8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185842, Expressed in intestine and 133 other tissues
ExpressionAtlasiQ0VDD8, baseline and differential
GenevisibleiQ0VDD8, HS

Family and domain databases

Gene3Di1.10.8.710, 1 hit
InterProiView protein in InterPro
IPR035699, AAA_6
IPR035706, AAA_9
IPR026980, DNAH6/14
IPR043157, Dynein_AAA1S
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR027417, P-loop_NTPase
PANTHERiPTHR46454:SF6, PTHR46454:SF6, 6 hits
PfamiView protein in Pfam
PF12774, AAA_6, 2 hits
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 2 hits
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF12777, MT, 1 hit
SUPFAMiSSF52540, SSF52540, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDYH14_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q0VDD8
Secondary accession number(s): A6NG62
, A6NNL2, Q0VDD9, Q4VXC7, Q4VXG4, Q4VXG5, Q5VU33, Q5VU34
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: February 26, 2008
Last modified: June 2, 2021
This is version 123 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again